Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.63
PubTator Score 3.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
24413464 Novel SCRG1/BST1 axis regulates self-renewal, migration, and osteogenic differentiation potential in mesenchymal stem cells.
24413464 Aomatsu et al. identified a novel SCRG1/BST1 (CD157) ligand-receptor combination that maintains human mesenchymal stem cells expressions of stem cell markers Oct-4 and CD271 (LNGFR), as well as self-renewal, migration, and osteogenic differentiation potentials during ex vivo expansion.

AA Sequence

MKLMVLVFTIGLTLLLGVQAMPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICY      1 - 70
CNFSELLCCPKDVFFGPKISFVIPCNNQ                                               71 - 98
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24413464 2014 Novel SCRG1/BST1 axis regulates self-renewal, migration, and osteogenic differentiation potential in mesenchymal stem cells.
16199891 2005 Comparative proteomic analysis of intra- and interindividual variation in human cerebrospinal fluid.
16188469 2006 A predominantly articular cartilage-associated gene, SCRG1, is induced by glucocorticoid and stimulates chondrogenesis in vitro.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9660755 1998 Characterization of the human analogue of a Scrapie-responsive gene.
9516475 1998 Gene expression in scrapie. Cloning of a new scrapie-responsive gene and the identification of increased levels of seven other mRNA transcripts.