Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.57
PubTator Score 3.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MKLMVLVFTIGLTLLLGVQAMPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICY      1 - 70
CNFSELLCCPKDVFFGPKISFVIPCNNQ                                               71 - 98
//

Text Mined References (9)

PMID Year Title