Property Summary

NCBI Gene PubMed Count 60
PubMed Score 2.72
PubTator Score 168.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Polycystic ovary syndrome 360 0.0 0.0
Retinitis pigmentosa 2 8 0.0 0.0
Disease Target Count
Retinitis Pigmentosa 226

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.700 8.1e-04
aldosterone-producing adenoma -1.267 2.2e-04
astrocytoma 1.800 8.4e-28
Astrocytoma, Pilocytic 2.100 9.9e-07
atypical teratoid / rhabdoid tumor 1.300 8.4e-04
breast carcinoma 1.400 2.7e-03
ependymoma 2.300 7.3e-10
glioblastoma 2.000 7.0e-10
lung cancer -1.300 1.8e-03
oligodendroglioma 1.700 1.2e-16
primary Sjogren syndrome 1.100 1.3e-03
primitive neuroectodermal tumor 1.300 7.3e-05
sonic hedgehog group medulloblastoma 1.100 2.3e-02

Gene RIF (35)

AA Sequence

MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENC      1 - 70
NIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESS     71 - 140
SNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAV    141 - 210
RVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRV    211 - 280
FREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI    281 - 350
//

Text Mined References (67)

PMID Year Title