Property Summary

NCBI Gene PubMed Count 21
Grant Count 5
R01 Count 4
Funding $198,979.93
PubMed Score 14.75
PubTator Score 8.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
group 3 medulloblastoma 1.500 0.000
medulloblastoma, large-cell 1.400 0.000
adrenocortical carcinoma 1.095 0.004
non-small cell lung cancer 1.949 0.000
lung cancer 1.900 0.004
colon cancer 1.300 0.000
Breast cancer 1.200 0.000

Synonym

Accession O75694 Q9UBE9 Q9UFL5
Symbols N155
ATFB15

Gene

PDB

5A9Q   5IJN   5IJO  

Gene RIF (11)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify 155kDa nucleoporin (NUP155), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify 155kDa nucleoporin (NUP155), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify 155kDa nucleoporin (NUP155), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify 155kDa nucleoporin (NUP155), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21994675 Tandem affinity purification and mass spectrometry analysis identify 155kDa nucleoporin (NUP155), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21464227 The Nup155-mediated localization was required for HDAC4's effect on gene expression.
20974814 The Nup155 depletion massively alters nuclear envelope structure, causing a dramatic decrease in Nuclear pore complexes numbers and the improper targeting of membrane proteins to the inner nuclear membrane.
20227665 Tandem affinity purification and mass spectrometry analysis identify 155kDa nucleoporin (NUP155), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19070573 These human and mouse studies indicate that loss of NUP155 function causes atrial fibrillation by altering mRNA and protein transport and link the nuclear pore complex to cardiovascular disease.
18976975 Knockdown of nucleoporin 155kDa (NUP155) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
More...

AA Sequence

MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPTVSGMSDMDYPLQGP      1 - 70
GLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGL     71 - 140
SETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSLPT    141 - 210
DNTYLLTITSTDNGRIFLAGKDGCLYEVAYQAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPIL    211 - 280
QIAIDNSRNILYTRSEKGVIQVYDLGQDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIEN    281 - 350
SESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHRALYSKGILLM    351 - 420
AASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDHIPITDSPVVV    421 - 490
QQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAA    491 - 560
CDREVSAWATRAFFRYGGEAQMRFPTTLPPPSNVGPILGSPVYSSSPVPSGSPYPNPSFLGTPSHGIQPP    561 - 630
AMSTPVCALGNPATQATNMSCVTGPEIVYSGKHNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIES    631 - 700
SVPCQLLESVLQELKGLQEFLDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEA    701 - 770
QLSEKISLQAIQQLVRKSYQALALWKLLCEHQFTIIVAELQKELQEQLKITTFKDLVIRDKELTGALIAS    771 - 840
LINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEYQKISNQ    841 - 910
VDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTLQ    911 - 980
ELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALYNWLIQVDLAD    981 - 1050
KLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIAR   1051 - 1120
AILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYG   1121 - 1190
EFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPR   1191 - 1260
FFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHVL   1261 - 1330
LIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLERLH            1331 - 1391
//

Text Mined References (31)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23152829 2012 Heart failure induces significant changes in nuclear pore complex of human cardiomyocytes.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21924735 The "missing" link in atrial fibrillation heritability.
21464227 2011 Modulation of chromatin position and gene expression by HDAC4 interaction with nucleoporins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...