Property Summary

NCBI Gene PubMed Count 32
PubMed Score 23.77
PubTator Score 24.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Luminal breast carcinoma 2 3.013 1.5

Expression

Gene RIF (18)

AA Sequence

MAKERRRAVLELLQRPGNARCADCGAPDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQV      1 - 70
EFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRG     71 - 140
RDNGQFLSRKFVLTEREGALKYFNRNDAKEPKAVMKIEHLNATFQPAKIGHPHGLQVTYLKDNSTRNIFI    141 - 210
YHEDGKEIVDWFNALRAARFHYLQVAFPGAGDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDR    211 - 280
RLMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVAA    281 - 350
FQKAVDRPMLPQEYAVEAHFKHKP                                                  351 - 374
//

Text Mined References (34)

PMID Year Title