Property Summary

NCBI Gene PubMed Count 32
PubMed Score 23.93
PubTator Score 24.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Luminal breast carcinoma 3 3.078 1.5

Expression

Synonym

Accession O75689 A4D2Q2 B3KRZ4 B4DVA6 F6XZ68 H7C2Q4
Symbols GCS1L
CENTA1
p42IP4

Gene

PDB

3FEH   3FM8   3LJU   3MDB  

Gene RIF (18)

PMID Text
24854535 This review highlights the functions of the neuron-specific protein ADAP1 in neuronal differentiation and neurodegenerative diseases, with an overview of structural and biochemical properties of ADAP1. [review]
21972134 Tubulin potentiates the interaction of the metalloendopeptidase nardilysin with the neuronal scaffold protein p42IP4/centaurin-alpha1 (ADAP1).
21801775 SH-SY5Y cells, stably transfected with GFP-tagged-p42(IP4), show an enhanced NRD protein expression already at an earlier time point after retinoic acid stimulation.
21057110 Full-length KIF13B and CENTA1 form heterotetramers that can bind four phosphoinositide molecules in the vesicle and transport it along the microtubule.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
18298663 The ARFGAP domain of p42IP4 is involved in the interaction and co-localization with RanBPM protein, without being the only interaction site.
16805830 p42IP4 binds to nardilysin via the acidic domain, and that this interaction is controlled by the cognate cellular ligands of p42IP4/centaurin-alpha1
16341594 Data show that membrane transport of p42(IP4) induced by epidermal growth factor is inhibited by stimulation of phospholipase C-coupled thrombin receptor.
More...

AA Sequence

MAKERRRAVLELLQRPGNARCADCGAPDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQV      1 - 70
EFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRG     71 - 140
RDNGQFLSRKFVLTEREGALKYFNRNDAKEPKAVMKIEHLNATFQPAKIGHPHGLQVTYLKDNSTRNIFI    141 - 210
YHEDGKEIVDWFNALRAARFHYLQVAFPGAGDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDR    211 - 280
RLMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVAA    281 - 350
FQKAVDRPMLPQEYAVEAHFKHKP                                                  351 - 374
//

Text Mined References (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24854535 2014 Functions of the neuron-specific protein ADAP1 (centaurin-?1) in neuronal differentiation and neurodegenerative diseases, with an overview of structural and biochemical properties of ADAP1.
21972134 2011 Tubulin potentiates the interaction of the metalloendopeptidase nardilysin with the neuronal scaffold protein p42IP4/centaurin-?1 (ADAP1).
21801775 2011 Retinoic acid-induced upregulation of the metalloendopeptidase nardilysin is accelerated by co-expression of the brain-specific protein p42(IP4) (centaurin ? 1; ADAP1) in neuroblastoma cells.
21057110 2010 Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
18298663 2008 RanBPM, a novel interaction partner of the brain-specific protein p42IP4/centaurin alpha-1.
More...