Property Summary

NCBI Gene PubMed Count 31
PubMed Score 35.08
PubTator Score 23.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Myocardial Ischemia 169
Disease Target Count P-value
posterior fossa group A ependymoma 1511 3.89128970441433E-8
glioblastoma 5572 1.55978951675583E-6
adult high grade glioma 2148 9.27202973656536E-4
ovarian cancer 8492 0.00200627780698797
atypical teratoid / rhabdoid tumor 4369 0.00254322143456577
medulloblastoma, large-cell 6234 0.00364338840631892
hereditary spastic paraplegia 313 0.00877477903178471
dermatomyositis 967 0.0120231480072473
subependymal giant cell astrocytoma 2287 0.0264463429347249
group 3 medulloblastoma 2254 0.0341757909529885
Rheumatoid Arthritis 1171 0.040261358372897
Waldenstrons macroglobulinemia 765 0.0484252304206218
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Vascular disease 281 0.0 1.0
Disease Target Count Z-score Confidence
Cystinuria 18 5.322 2.7

Expression

Synonym

Accession O75688 Q461Q2 Q4J6C1 Q4J6C2 Q658R4 Q96ER6 Q9HAY8
Symbols PP2CB
PP2CBETA
PP2C-beta
PPC2BETAX
PP2C-beta-X

Gene

PDB

2P8E  

  Ortholog (12)

Gene RIF (12)

PMID Text
25631048 PPM1B interacts with Groucho 4 and is localized to DNA in a Groucho-dependent manner, and phosphatase activity is required for transcriptional silencing.
24674756 Results identify PPM1B as a critical regulator of both p38 MAPK-dependent and independent senescence pathways during normal cellular aging process.
23903585 Cadmium reversed PPM1A-induced cell cycle arrest and cadmium insensitive PPM1A mutant rescued cadmium induced cell death.
23756813 Protein kinase A activates NF-kappaB-mediated transcription by destabilization of PP2Cbeta.
23320500 the phosphatase PPM1B as a novel selective modulator of PPARgamma activity.
22750291 PPM1B functions as a TBK1 phosphatase dephosphorylates TBK1 at serine 172 and terminates TBK1-mediated IRF3 activation and IFNbeta gene expression.
22393050 Studies show that Ppm1b plays a multilayered role in regulating the availability and optimal activity of the EKLF protein in erythroid cells.
20538721 results implicate a novel and important role for PP2Cbetal in regulating hPXR activity and CYP3A4 expression by inhibiting or desensitizing signaling pathways that negatively regulate the function of pregnane X receptor in liver cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18930133 Protein phosphatase 1B is mediated dephosphorylation and inactivation of I-kappa B kinase as well as the termination of the Tumor Necrosis Factor-alpha-induced NF-kappaappaB activation.
More...

AA Sequence

MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANY      1 - 70
CSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMIS     71 - 140
PKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCV    141 - 210
DGKGPTEQLVSPEPEVYEILRAEEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCL    211 - 280
HKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNL    281 - 350
PPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRL    351 - 420
AKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI               421 - 479
//

Text Mined References (40)

PMID Year Title
25631048 2015 The Groucho-associated phosphatase PPM1B displaces Pax transactivation domain interacting protein (PTIP) to switch the transcription factor Pax2 from a transcriptional activator to a repressor.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24674756 2014 PPM1B depletion induces premature senescence in human IMR-90 fibroblasts.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23903585 2013 Cadmium is a potent inhibitor of PPM phosphatases and targets the M1 binding site.
23756813 2013 PKA negatively regulates PP2C? to activate NF-?B-mediated inflammatory signaling.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23320500 2013 The serine/threonine phosphatase PPM1B (PP2C?) selectively modulates PPAR? activity.
22781750 2012 Protein phosphatase 5 modulates SMAD3 function in the transforming growth factor-? pathway.
More...