Property Summary

Ligand Count 5
NCBI Gene PubMed Count 32
PubMed Score 36.26
PubTator Score 23.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.400 9.3e-04
atypical teratoid / rhabdoid tumor -1.300 2.5e-03
dermatomyositis 1.100 1.2e-02
ependymoma -1.300 1.5e-07
glioblastoma -1.400 1.6e-06
group 3 medulloblastoma -1.300 3.4e-02
hereditary spastic paraplegia -1.204 8.8e-03
medulloblastoma, large-cell -1.200 3.6e-03
ovarian cancer -1.300 2.0e-03
Rheumatoid arthritis 1.600 4.0e-02
subependymal giant cell astrocytoma -1.098 2.6e-02
Waldenstrons macroglobulinemia 1.006 4.8e-02

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (13)

AA Sequence

MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANY      1 - 70
CSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMIS     71 - 140
PKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCV    141 - 210
DGKGPTEQLVSPEPEVYEILRAEEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCL    211 - 280
HKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNL    281 - 350
PPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRL    351 - 420
AKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI               421 - 479
//

Text Mined References (41)

PMID Year Title