Property Summary

NCBI Gene PubMed Count 31
Grant Count 8
R01 Count 5
Funding $415,246
PubMed Score 35.08
PubTator Score 23.24

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
25631048 PPM1B interacts with Groucho 4 and is localized to DNA in a Groucho-dependent manner, and phosphatase activity is required for transcriptional silencing.
24674756 Results identify PPM1B as a critical regulator of both p38 MAPK-dependent and independent senescence pathways during normal cellular aging process.
23903585 Cadmium reversed PPM1A-induced cell cycle arrest and cadmium insensitive PPM1A mutant rescued cadmium induced cell death.
23756813 Protein kinase A activates NF-kappaB-mediated transcription by destabilization of PP2Cbeta.
23320500 the phosphatase PPM1B as a novel selective modulator of PPARgamma activity.
22750291 PPM1B functions as a TBK1 phosphatase dephosphorylates TBK1 at serine 172 and terminates TBK1-mediated IRF3 activation and IFNbeta gene expression.
22393050 Studies show that Ppm1b plays a multilayered role in regulating the availability and optimal activity of the EKLF protein in erythroid cells.
20538721 results implicate a novel and important role for PP2Cbetal in regulating hPXR activity and CYP3A4 expression by inhibiting or desensitizing signaling pathways that negatively regulate the function of pregnane X receptor in liver cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18930133 Protein phosphatase 1B is mediated dephosphorylation and inactivation of I-kappa B kinase as well as the termination of the Tumor Necrosis Factor-alpha-induced NF-kappaappaB activation.
More...

AA Sequence

MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANY      1 - 70
CSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMIS     71 - 140
PKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCV    141 - 210
DGKGPTEQLVSPEPEVYEILRAEEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCL    211 - 280
HKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNL    281 - 350
PPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRL    351 - 420
AKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI               421 - 479
//

Text Mined References (40)

PMID Year Title
25631048 2015 The Groucho-associated phosphatase PPM1B displaces Pax transactivation domain interacting protein (PTIP) to switch the transcription factor Pax2 from a transcriptional activator to a repressor.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24674756 2014 PPM1B depletion induces premature senescence in human IMR-90 fibroblasts.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23903585 2013 Cadmium is a potent inhibitor of PPM phosphatases and targets the M1 binding site.
23756813 2013 PKA negatively regulates PP2C? to activate NF-?B-mediated inflammatory signaling.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23320500 2013 The serine/threonine phosphatase PPM1B (PP2C?) selectively modulates PPAR? activity.
22781750 2012 Protein phosphatase 5 modulates SMAD3 function in the transforming growth factor-? pathway.
More...