Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.99
PubTator Score 2.23

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (5)

PMID Text
26318425 RFPL3 and CBP have roles in upregulating hTERT activity and promoting lung cancer growth
25481043 These results demonstrate that RFPL3 is an important cellular factor which promotes lung cancer growth by activating hTERT expression
25107902 RFPL3 is a potential stimulator of human immunodeficiency virus, type 1 (HIV-1) preintegration complex integration.
25107902 RFPL3 enhances the preintegration complex (PIC) integration activity in vitro, suggesting that HIV-1 IN interacts with RFPL3 in cells
18656177 the human RFPL1,2,3 genes have a role in neocortex development

AA Sequence

MKRLSLVTTNRLSPQGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCTVCLKCINSLQKE      1 - 70
PHGEDLLCCCCSMVSQRNKIRPNRQLERLVSHIKELEPKLKKILQMNPRMRKFQVDMTLDADTANNFLLI     71 - 140
SDDLRSVRSGLITQNRQDLAERFDVSVCILGSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHCKGKIQLT    141 - 210
TELGFWTVSLRDGSRLSASTVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPLR    211 - 280
PFLAPSIPPNGDQGVLSICPLMNSGTTDAPVRPGEAK                                     281 - 317
//

Text Mined References (11)

PMID Year Title
26318425 2015 RFPL3 and CBP synergistically upregulate hTERT activity and promote lung cancer growth.
25481043 2014 Ret finger protein-like 3 promotes tumor cell growth by activating telomerase reverse transcriptase expression in human lung cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25107902 2014 Identification of RFPL3 protein as a novel E3 ubiquitin ligase modulating the integration activity of human immunodeficiency virus, type 1 preintegration complex using a microtiter plate-based assay.
18656177 2008 Evolutionary forces shape the human RFPL1,2,3 genes toward a role in neocortex development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
More...