Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.99
PubTator Score 2.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
posterior fossa group A ependymoma 468 6.2e-07
group 3 medulloblastoma 4104 4.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma -1.100 4.5e-03
posterior fossa group A ependymoma -1.100 6.2e-07

Gene RIF (5)

AA Sequence

MKRLSLVTTNRLSPQGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCTVCLKCINSLQKE      1 - 70
PHGEDLLCCCCSMVSQRNKIRPNRQLERLVSHIKELEPKLKKILQMNPRMRKFQVDMTLDADTANNFLLI     71 - 140
SDDLRSVRSGLITQNRQDLAERFDVSVCILGSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHCKGKIQLT    141 - 210
TELGFWTVSLRDGSRLSASTVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPLR    211 - 280
PFLAPSIPPNGDQGVLSICPLMNSGTTDAPVRPGEAK                                     281 - 317
//

Text Mined References (11)

PMID Year Title