Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.07
PubTator Score 0.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.156 0.002
ependymoma -1.700 0.000
glioblastoma -1.900 0.000
medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.700 0.002
primitive neuroectodermal tumor -1.800 0.000
pediatric high grade glioma -1.500 0.000
pilocytic astrocytoma -1.600 0.000
facioscapulohumeral dystrophy 6.500 0.000

Gene RIF (1)

PMID Text
18656177 the human RFPL1,2,3 genes have a role in neocortex development

AA Sequence

MEVAELGFPETAVSQSRICLCAVLCGHWDFADMMVIRSLSLIRLEGVEGRDPVGGGNLTNKRPSCAPSPQ      1 - 70
DLSAQWKQLEDRGASSRRVDMAALFQEASSCPVCSDYLEKPMSLECGCAVCLKCINSLQKEPHGEDLLCC     71 - 140
CSSMVSRKNKIRRNRQLERLASHIKELEPKLKKILQMNPRMRKFQVDMTLDANTANNFLLISDDLRSVRS    141 - 210
GRIRQNRQDLAERFDVSVCILGSPRFTCGRHCWEVDVGTSTEWDLGVCRESVHRKGRIQLTTELGFWTVS    211 - 280
LRDGGRLSATTVPLTFLFVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPP    281 - 350
NGDQGVLSICPLMNSGTTDAPVRPGEAK                                              351 - 378
//

Text Mined References (7)

PMID Year Title
18656177 2008 Evolutionary forces shape the human RFPL1,2,3 genes toward a role in neocortex development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
10508838 1999 Duplications on human chromosome 22 reveal a novel Ret Finger Protein-like gene family with sense and endogenous antisense transcripts.