Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.07
PubTator Score 0.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.100 1.1e-02
Astrocytoma, Pilocytic -1.700 3.3e-06
atypical teratoid / rhabdoid tumor -1.800 1.2e-07
ependymoma -1.700 9.7e-14
facioscapulohumeral dystrophy 6.500 1.6e-34
glioblastoma -1.400 6.7e-07
group 3 medulloblastoma -1.300 2.5e-02
medulloblastoma, large-cell -1.700 2.0e-03
osteosarcoma -1.156 2.3e-03
primitive neuroectodermal tumor -1.800 2.1e-04

Gene RIF (1)

AA Sequence

MEVAELGFPETAVSQSRICLCAVLCGHWDFADMMVIRSLSLIRLEGVEGRDPVGGGNLTNKRPSCAPSPQ      1 - 70
DLSAQWKQLEDRGASSRRVDMAALFQEASSCPVCSDYLEKPMSLECGCAVCLKCINSLQKEPHGEDLLCC     71 - 140
CSSMVSRKNKIRRNRQLERLASHIKELEPKLKKILQMNPRMRKFQVDMTLDANTANNFLLISDDLRSVRS    141 - 210
GRIRQNRQDLAERFDVSVCILGSPRFTCGRHCWEVDVGTSTEWDLGVCRESVHRKGRIQLTTELGFWTVS    211 - 280
LRDGGRLSATTVPLTFLFVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPP    281 - 350
NGDQGVLSICPLMNSGTTDAPVRPGEAK                                              351 - 378
//

Text Mined References (7)

PMID Year Title