Property Summary

NCBI Gene PubMed Count 29
Grant Count 17
R01 Count 11
Funding $705,771.65
PubMed Score 9.68
PubTator Score 10.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -2.600 0.017
oligodendroglioma -2.400 0.047
psoriasis 1.400 0.000
osteosarcoma 2.004 0.000
posterior fossa group A ependymoma 1.700 0.000
glioblastoma 1.100 0.005
cystic fibrosis 1.002 0.000
atypical teratoid/rhabdoid tumor 2.200 0.000
lung cancer 1.100 0.001
interstitial cystitis -1.800 0.000
sonic hedgehog group medulloblastoma 2.000 0.000
pilocytic astrocytoma 1.100 0.001
lung adenocarcinoma 1.006 0.000
ductal carcinoma in situ 1.800 0.014
invasive ductal carcinoma 2.700 0.001
ovarian cancer -1.900 0.000

Gene RIF (10)

PMID Text
26899482 TOM1L1 enhances ERBB2-induced cell invasiveness by promoting invadopodia formation and MT1-MMP trafficking to the plasma membrane.
23023324 whereas TOM1L1 depletion only slightly affected SRC-induced proliferation of colorectal cancer cells in vitro, it drastically decreased tumor growth in xenografted nude mice.
20944134 This pattern of Srcasm expression suggests that it may act as a negative regulator in esophageal squamous cell carcinoma cell signaling
20182632 results imply that TOM1L has a mitogenic effect in Jurkat T-cells and is involved in a novel cell signaling pathway that is crucial for the IL-2 production and STAT3 expression
19798056 Participation of Tom1L1 in EGF-stimulated endocytosis of EGF receptor.
19220627 All multicentric and nodular basal cell carcinomas displayed a prominent loss of Srcasm staining in association with a marked increase in Ki-67 staining.
18367816 study found that not only the PTAP sequence in the GAT domain but also the PSAP sequence in the C-terminal region of Tom1L1 is responsible for its interaction with the UEV domain of Tsg101 and competes with the HIV-1 Gag protein for the Tsg101 interaction
18367816 The PTAP sequence (179-182) in the GAT domain and the PSAP sequence (310-313) in the C-terminal region of Tom1L1 are required for its interaction with the UEV domain (1-145) of Tsg101 and competes with HIV-1 Gag
15611048 Tom1L1 could act as an intermediary between signaling and degradative pathways.
15579470 Srcasm plays a role in linking EGF receptor- and SFK-dependent signaling to differentiation in keratinocytes

AA Sequence

MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDIINTTQDGPKDAVKALKKRISKNYNHKEIQ      1 - 70
LTLSLIDMCVQNCGPSFQSLIVKKEFVKENLVKLLNPRYNLPLDIQNRILNFIKTWSQGFPGGVDVSEVK     71 - 140
EVYLDLVKKGVQFPPSEAEAETARQETAQISSNPPTSVPTAPALSSVIAPKNSTVTLVPEQIGKLHSELD    141 - 210
MVKMNVRVMSAILMENTPGSENHEDIELLQKLYKTGREMQERIMDLLVVVENEDVTVELIQVNEDLNNAI    211 - 280
LGYERFTRNQQRILEQNKNQKEATNTTSEPSAPSQDLLDLSPSPRMPRATLGELNTMNNQLSGLNFSLPS    281 - 350
SDVTNNLKPSLHPQMNLLALENTEIPPFAQRTSQNLTSSHAYDNFLEHSNSVFLQPVSLQTIAAAPSNQS    351 - 420
LPPLPSNHPAMTKSDLQPPNYYEVMEFDPLAPAVTTEAIYEEIDAHQHKGAQNDGD                  421 - 476
//

Text Mined References (38)

PMID Year Title
26899482 2016 TOM1L1 drives membrane delivery of MT1-MMP to promote ERBB2-induced breast cancer cell invasion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23023324 2012 Analysis of SRC oncogenic signaling in colorectal cancer by stable isotope labeling with heavy amino acids in mouse xenografts.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
20944134 2010 Decreased Srcasm expression in esophageal squamous cell carcinoma in a Chinese population.
More...