Property Summary

NCBI Gene PubMed Count 13
PubMed Score 34.82
PubTator Score 518.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
aldosterone-producing adenoma -1.045 1.2e-02
astrocytic glioma -1.200 3.7e-02
atypical teratoid / rhabdoid tumor -1.200 1.6e-04
Breast cancer 2.500 2.5e-02
Crohn's disease -1.099 7.4e-04
ependymoma -1.400 3.2e-02
gastric cancer 1.300 1.3e-03
glioblastoma -1.100 2.6e-04
group 3 medulloblastoma 1.300 1.4e-02
hepatocellular carcinoma 1.300 1.7e-06
intraductal papillary-mucinous adenoma (... 1.100 3.0e-03
intraductal papillary-mucinous neoplasm ... 1.600 1.1e-02
invasive ductal carcinoma 1.100 1.9e-02
malignant mesothelioma 1.200 1.8e-04
medulloblastoma, large-cell -1.200 4.1e-03
oligodendroglioma -1.400 4.0e-02
ovarian cancer -1.300 1.5e-04
pancreatic cancer 1.300 8.7e-04
pancreatic carcinoma 1.300 8.7e-04
ulcerative colitis -1.343 2.2e-03

Synonym

Accession O75663 B2R8V3 Q5HYB2 Q8IZ86
Symbols TIP
TIP41
TIPRL1

Gene

PDB

5D9G  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MMIHGFQSSHRDFCFGPWKLTASKTHIMKSADVEKLADELHMPSLPEMMFGDNVLRIQHGSGFGIEFNAT      1 - 70
DALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIKPYDWTYTTDYKGTLLGESLKLKVVPTTDHIDTEK     71 - 140
LKAREQIKFFEEVLLFEDELHDHGVSSLSVKIRVMPSSFFLLLRFFLRIDGVLIRMNDTRLYHEADKTYM    141 - 210
LREYTSRESKISSLMHVPPSLFTEPNEISQYLPIKEAVCEKLIFPERIDPNPADSQKSTQVE            211 - 272
//

Text Mined References (22)

PMID Year Title