Property Summary

NCBI Gene PubMed Count 13
PubMed Score 33.85
PubTator Score 518.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
hepatocellular carcinoma 550 1.72793711408722E-6
atypical teratoid / rhabdoid tumor 4369 1.64088234691909E-4
malignant mesothelioma 3163 1.77211245333023E-4
ovarian cancer 8492 2.36824957550632E-4
glioblastoma 5572 2.56204348265699E-4
Crohn's disease 304 7.36730050100566E-4
pancreatic carcinoma 567 8.66589705382503E-4
pancreatic cancer 2300 8.66589705382507E-4
gastric cancer 436 0.00133821327698879
ulcerative colitis 2087 0.00221044878015156
medulloblastoma, large-cell 6234 0.00408969058396186
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0110972351709396
aldosterone-producing adenoma 664 0.0116697885212388
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0134011625875541
group 3 medulloblastoma 2254 0.0141503144934674
invasive ductal carcinoma 2950 0.0192619616376434
astrocytic glioma 2241 0.0231771315429044
Breast cancer 3099 0.0248609387717636
ependymoma 2514 0.0318301299936334
oligodendroglioma 2849 0.0403710465149863

Expression

  Differential Expression (20)

Synonym

Accession O75663 B2R8V3 Q5HYB2 Q8IZ86
Symbols TIP
TIP41
TIPRL1

Gene

PDB

5D9G  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
26717153 overexpression of TIPRL promotes phosphorylation of H2AX, and increases gamma-H2AX positive foci in response to DNA damage, whereas knockdown of TIPRL inhibits gamma-H2AX phosphorylation
23892082 Unlike yeast TIP41, TIPRL has a positive effect on mTORC1 signaling through the association with PP2Ac.
22841785 TIPRL is highly up-regulated in human HCC samples and cell lines, compared with noncancerous liver tissues.
22443683 Data indicate that PP2A holoenzyme biogenesis and activity are controlled by five PP2A modulators, consisting of alpha4, PTPA, LCMT1, PME-1 and TIPRL1, which serve to prevent promiscuous phosphatase activity until the holoenzyme is completely assembled.
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MMIHGFQSSHRDFCFGPWKLTASKTHIMKSADVEKLADELHMPSLPEMMFGDNVLRIQHGSGFGIEFNAT      1 - 70
DALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIKPYDWTYTTDYKGTLLGESLKLKVVPTTDHIDTEK     71 - 140
LKAREQIKFFEEVLLFEDELHDHGVSSLSVKIRVMPSSFFLLLRFFLRIDGVLIRMNDTRLYHEADKTYM    141 - 210
LREYTSRESKISSLMHVPPSLFTEPNEISQYLPIKEAVCEKLIFPERIDPNPADSQKSTQVE            211 - 272
//

Text Mined References (21)

PMID Year Title
26717153 2015 TIPRL Inhibits Protein Phosphatase 4 Activity and Promotes H2AX Phosphorylation in the DNA Damage Response.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23892082 2013 A positive role of mammalian Tip41-like protein, TIPRL, in the amino-acid dependent mTORC1-signaling pathway through interaction with PP2A.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22841785 2012 Inhibition of MKK7-JNK by the TOR signaling pathway regulator-like protein contributes to resistance of HCC cells to TRAIL-induced apoptosis.
22443683 2013 The biogenesis of active protein phosphatase 2A holoenzymes: a tightly regulated process creating phosphatase specificity.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
More...