Property Summary

NCBI Gene PubMed Count 22
PubMed Score 142.32
PubTator Score 25.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Leigh disease 100 0.0 5.0

Expression

  Differential Expression (6)

Disease log2 FC p
Atopic dermatitis 1.100 8.6e-05
group 3 medulloblastoma 2.300 4.7e-05
lung cancer 1.400 4.8e-04
medulloblastoma, large-cell 1.800 3.5e-05
osteosarcoma -1.635 9.0e-03
primitive neuroectodermal tumor 1.300 2.1e-02

Gene RIF (14)

AA Sequence

MQALRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEHGVCTADKDCEDAYRVCQILDIPFHQ      1 - 70
VSYVKEYWNDVFSDFLNEYEKGRTPNPDIVCNKHIKFSCFFHYAVDNLGADAIATGHYARTSLEDEEVFE     71 - 140
QKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQVSQDALRRTIFPLGGLTKEFVKKIAAENRLH    141 - 210
HVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVV    211 - 280
EKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDG    281 - 350
TVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPL    351 - 420
L//

Text Mined References (24)

PMID Year Title