Property Summary

NCBI Gene PubMed Count 50
PubMed Score 54.44
PubTator Score 35.32

Knowledge Summary


No data available


  Disease (5)

Disease Target Count Z-score Confidence
Retinitis pigmentosa 33 4 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.8
Disease Target Count
Retinitis Pigmentosa 226


  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia 1.800 2.2e-02
astrocytic glioma 1.400 1.8e-02
dermatomyositis 1.400 2.9e-04
diabetes mellitus -1.600 2.9e-02
ependymoma 1.700 1.2e-02
group 3 medulloblastoma 1.200 1.5e-04
lung cancer 1.200 4.0e-04
medulloblastoma, large-cell 1.100 1.6e-04
oligodendroglioma 2.000 2.9e-03
osteosarcoma 1.001 9.5e-03
ovarian cancer -1.500 7.8e-13
pancreatic cancer 1.100 1.3e-02
primitive neuroectodermal tumor 1.200 3.2e-05
psoriasis 1.300 1.1e-04

 GWAS Trait (1)

Gene RIF (16)

AA Sequence

AHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD                                     2101 - 2136

Text Mined References (63)

PMID Year Title