Property Summary

NCBI Gene PubMed Count 28
PubMed Score 34.85
PubTator Score 161.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 3.493 1.7

Expression

Synonym

Accession O75638 O75637 Q0VIL6 Q14CD6 Q2Z1N4 Q9BU80 Q9UJ89 Q9Y479 CT2
Symbols CT2
ESO2
CAMEL
CT6.2
CT6.2a
CT6.2b
LAGE-1
LAGE2B

Gene

Gene RIF (15)

AA Sequence

MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAAS      1 - 70
AQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQ     71 - 140
DREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI    141 - 210
//

Text Mined References (30)

PMID Year Title