Property Summary

NCBI Gene PubMed Count 28
Grant Count 4
R01 Count 1
Funding $273,522.5
PubMed Score 33.28
PubTator Score 161.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cancer 2,346 3.448 1.7

Gene RIF (15)

PMID Text
24885297 The tumor suppressor function of LSAMP is most likely exerted by reducing the proliferation rate of the tumor cells, possibly by indirectly upregulating one or more of the genes HES1, CTAG2 or KLF10.
22384167 NYESO-1/LAGE-1s and PRAME are targets for antigen specific T cells in chondrosarcoma following treatment with 5-Aza-2-deoxycitabine
21247062 LAGE-1a and NY-ESO-1 homology cannot be easily exploited in an anti-NY-ESO-1 vaccine given the low frequency of protein expression detected by IHC or serum analysis.
21131422 Spontaneous LAGE-1-specific CD4-positive T cells isolated from patients with advanced LAGE-1-positive/NY-ESO-1-positive melanoma are directed against three promiscuous and immunodominant epitopes.
19212631 We evaluated the correlations among the expression levels of NY-ESO-1, LAGE-1 and SSX-1 and clinical parameters in hepatocellular carcinoma patients
18237105 MAGEC1/CT7, MAGEA3/6 and LAGE-1 are good candidates for immunotherapy, since together they cover 85% of the multiple myeloma cases.
17899192 There is a high frequency of the LAGE-1 gene allele with SNPs in coding regions in cancer patients.
17899192 Observational study of gene-disease association. (HuGE Navigator)
16446548 LAGE-1 expression was detected in esophageal cancer by cDNA RDA. LAGE-1 might have the potential to be a target antigen for anti-tumoral immunotherapy in esophageal cancers because of its tumor-specific expression similar to that of MAGE-A1.
15540228 first peptide epitope recognized by sera from a wide spectrum of cancer patients but not healthy donors
More...

AA Sequence

MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAAS      1 - 70
AQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQ     71 - 140
DREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI    141 - 210
//

Text Mined References (30)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24885297 2014 Reexpression of LSAMP inhibits tumor growth in a preclinical osteosarcoma model.
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.
22384167 2012 NYESO-1/LAGE-1s and PRAME are targets for antigen specific T cells in chondrosarcoma following treatment with 5-Aza-2-deoxycitabine.
21247062 2011 Evaluation of LAGE-1 and NY-ESO-1 expression in multiple myeloma patients to explore possible benefits of their homology for immunotherapy.
21131422 2011 Epitope hierarchy of spontaneous CD4+ T cell responses to LAGE-1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19212631 2009 Comparisons for detecting NY-ESO-1 mRNA expression levels in hepatocellular carcinoma tissues.
18237105 2008 Prognostic impact of cancer/testis antigen expression in advanced stage multiple myeloma patients.
17899192 2008 Identification and expression analysis of novel LAGE-1 alleles with single nucleotide polymorphisms in cancer patients.
More...