Property Summary

NCBI Gene PubMed Count 52
PubMed Score 50.79
PubTator Score 17.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession O75636 Q6IBJ5 Q8WW86
Symbols FCNH
HAKA1

Gene

PANTHER Protein Class (1)

PDB

1LA5   2J5Z   2J60   2J64  

Gene RIF (37)

PMID Text
26627059 Lower serum ficolin-3 levels were correlated with injury severity following traumatic brain injury.
26154564 Data indicate differences in the plasma concentrations of collectin liver 1 and collectin kidney 1, M-ficolin and H-ficol in systemic lupus erythematosus (SLE) patients compared to a group of healthy controls.
26133042 H-ficolin participates in A. fumigatus defence through the activation of the lectin complement pathway, enhanced fungus-host interactions and modulated immune responses.
26074063 this study provide novel insight in the binding and complement activating capacity of the lectin pathway initiation molecules ficolin-2 and ficolin-3 towards relevant Gram-negative pathogens of pathophysiological relevance.
25222012 High ficolin-3 level at the time of transplantation was an independent significant risk factor for shorter graft survival.
25083730 There is lack of association of serum mannose-binding lectin or ficolins with complement activation in patients with antiphospholipid antibodies.
25069872 This study aims to investigate whether an association exists between the ficolins that are part of the lectin complement pathway and systemic lupus erythematosus.
25064124 data suggest that high levels of the complement activating molecule H-ficolin are associated with an increased risk of future progression to microalbuminuria in patients with newly diagnosed type 1 diabetes.
25042985 Both ficolin-3 and MASP-2 levels correlated inversely with the time from the onset of the attack of hereditary angioedema until blood sampling
25001927 Data show that the plasmid pETb-ficolin 3 was cloned successfully and the purity of the protein His-ficolin 3 was over 90%.
More...

AA Sequence

MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGK      1 - 70
MGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGS     71 - 140
VDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLA    141 - 210
LGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGID    211 - 280
WASGRGVGHPYRRVRMMLR                                                       281 - 299
//

Text Mined References (56)

PMID Year Title
26627059 2015 Low serum ficolin-3 levels are associated with severity and poor outcome in traumatic brain injury.
26154564 2015 Collectin liver 1 and collectin kidney 1 and other complement-associated pattern recognition molecules in systemic lupus erythematosus.
26133042 2015 H-ficolin binds Aspergillus fumigatus leading to activation of the lectin complement pathway and modulation of lung epithelial immune responses.
26074063 2015 Studies of the binding of ficolin-2 and ficolin-3 from the complement lectin pathway to Leptospira biflexa, Pasteurella pneumotropica and Diarrheagenic Escherichia coli.
25222012 2015 High ficolin-3 level at the time of transplantation is an independent risk factor for graft loss in kidney transplant recipients.
25083730 2014 Lack of association of serum mannose/mannan binding lectin or ficolins with complement activation in patients with antiphospholipid antibodies.
25069872 2015 Ficolins and the lectin pathway of complement in patients with systemic lupus erythematosus.
25064124 2014 Association of the pattern recognition molecule H-ficolin with incident microalbuminuria in an inception cohort of newly diagnosed type 1 diabetic patients: an 18 year follow-up study.
25042985 2014 Activation of the ficolin-lectin pathway during attacks of hereditary angioedema.
25001927 2014 [Expression and purification ficolin 3 and its role for RAW264.7 macrophage activation in vitro].
More...