Property Summary

NCBI Gene PubMed Count 60
PubMed Score 54.18
PubTator Score 17.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma -1.279 2.7e-02
group 3 medulloblastoma 1.100 3.4e-03
lung adenocarcinoma -3.000 2.3e-12
lung cancer -2.000 2.6e-04
lung carcinoma -3.900 1.1e-21
non-small cell lung cancer -4.340 1.4e-27
pancreatic ductal adenocarcinoma liver m... -3.440 4.3e-03
type II diabetes mellitus and post-ische... -1.600 2.1e-02

Gene RIF (45)

AA Sequence

MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGK      1 - 70
MGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGS     71 - 140
VDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLA    141 - 210
LGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGID    211 - 280
WASGRGVGHPYRRVRMMLR                                                       281 - 299
//

Text Mined References (64)

PMID Year Title