Property Summary

NCBI Gene PubMed Count 35
PubMed Score 51.22
PubTator Score 46.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
active ulcerative colitis 1.391 7.4e-03
Atopic dermatitis -2.800 1.7e-05
cystic fibrosis 1.620 1.5e-04
malignant mesothelioma -6.000 3.3e-10
nasopharyngeal carcinoma -1.700 9.1e-07
non-small cell lung cancer 1.009 4.1e-06
psoriasis 1.100 3.4e-04
spina bifida -2.514 4.2e-02

Gene RIF (30)

AA Sequence

MASLAAANAEFCFNLFREMDDNQGNGNVFFSSLSLFAALALVRLGAQDDSLSQIDKLLHVNTASGYGNSS      1 - 70
NSQSGLQSQLKRVFSDINASHKDYDLSIVNGLFAEKVYGFHKDYIECAEKLYDAKVERVDFTNHLEDTRR     71 - 140
NINKWVENETHGKIKNVIGEGGISSSAVMVLVNAVYFKGKWQSAFTKSETINCHFKSPKCSGKAVAMMHQ    141 - 210
ERKFNLSVIEDPSMKILELRYNGGINMYVLLPENDLSEIENKLTFQNLMEWTNPRRMTSKYVEVFFPQFK    211 - 280
IEKNYEMKQYLRALGLKDIFDESKADLSGIASGGRLYISRMMHKSYIEVTEEGTEATAATGSNIVEKQLP    281 - 350
QSTLFRADHPFLFVIRKDDIILFSGKVSCP                                            351 - 380
//

Text Mined References (38)

PMID Year Title