Property Summary

NCBI Gene PubMed Count 27
Grant Count 17
R01 Count 7
Funding $1,630,037.14
PubMed Score 78.55
PubTator Score 57.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
urothelial carcinoma -3.300 0.003
interstitial cystitis -5.700 0.000

Gene RIF (14)

PMID Text
25743828 High expression level of preoperative serum Uroplakin III is associated with biologically aggressive bladder cancer.
25368291 High Uroplakin III expression is associated with bladder urothelial carcinoma from malignancy metastatic to the urinary bladder.
24553301 a strong association between UPIII and in the group with tumor recurrence
22632162 FITC-labeled Tat 47-59 peptide downregulates gene expression of uroplakin 3A (UPK3A) in U-937 macrophages
19959718 Observational study of gene-disease association. (HuGE Navigator)
19412341 studies suggest that bacteria-induced UPIIIa signaling is a critical mediator of bladder responses to insult by uropathogenic E. coli
19007907 Uroplakin III plays a pivotal role in Eshcerichia coli UTI pathogenesis.
18528285 Not a useful immunohistochemical marker for detection of pleural malignant mesothelioma.
18313120 Loss of UP III expression is associated with established markers of biologically aggressive bladder cancer
17880289 Uroplakin III mRNA is up-regulated to a greater extent in vesicoureteral reflux than in control exfoliated urinary cells.
More...

AA Sequence

MPPLWALLALGCLRFGSAVNLQPQLASVTFATNNPTLTTVALEKPLCMFDSKEALTGTHEVYLYVLVDSA      1 - 70
ISRNASVQDSTNTPLGSTFLQTEGGRTGPYKAVAFDLIPCSDLPSLDAIGDVSKASQILNAYLVRVGANG     71 - 140
TCLWDPNFQGLCNAPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTPYSTIDTWPGRRSGGMIV    141 - 210
ITSILGSLPFFLLVGFAGAIALSLVDMGSSDGETTHDSQITQEAVPKSLGASESSYTSVNRGPPLDRAEV    211 - 280
YSSKLQD                                                                   281 - 287
//

Text Mined References (29)

PMID Year Title
25743828 2015 High expression level of preoperative serum Uroplakin III is associated with biologically aggressive bladder cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25368291 2014 Value of uroplakin III in distinguishing variants of primary bladder urothelial carcinoma from malignancy metastatic to the urinary bladder.
24553301 2014 Significance of uroplakin III expression in recurrence of solitary muscle non-invasive bladder cancer.
23541324 2013 Genome-wide association study identifies TH1 pathway genes associated with lung function in asthmatic patients.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19959718 2010 Whole-genome linkage and association scan in primary, nonsyndromic vesicoureteric reflux.
19412341 2009 Bacteria-induced uroplakin signaling mediates bladder response to infection.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...