Property Summary

NCBI Gene PubMed Count 27
PubMed Score 83.95
PubTator Score 57.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis -4.500 1.3e-03
urothelial carcinoma -3.300 3.2e-03

Gene RIF (14)

AA Sequence

MPPLWALLALGCLRFGSAVNLQPQLASVTFATNNPTLTTVALEKPLCMFDSKEALTGTHEVYLYVLVDSA      1 - 70
ISRNASVQDSTNTPLGSTFLQTEGGRTGPYKAVAFDLIPCSDLPSLDAIGDVSKASQILNAYLVRVGANG     71 - 140
TCLWDPNFQGLCNAPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTPYSTIDTWPGRRSGGMIV    141 - 210
ITSILGSLPFFLLVGFAGAIALSLVDMGSSDGETTHDSQITQEAVPKSLGASESSYTSVNRGPPLDRAEV    211 - 280
YSSKLQD                                                                   281 - 287
//

Text Mined References (29)

PMID Year Title