Property Summary

NCBI Gene PubMed Count 33
Grant Count 4
R01 Count 2
Funding $862,799
PubMed Score 113.90
PubTator Score 41.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 2.009 0.000
malignant mesothelioma -1.600 0.000
acute quadriplegic myopathy 1.526 0.000
Atopic dermatitis -1.100 0.000
adrenocortical carcinoma -1.224 0.000
diabetes mellitus -1.200 0.010
ovarian cancer 1.900 0.000

Gene RIF (20)

PMID Text
26722374 These results indicate that CREG1 is a down-stream effector of KRAS in a sub-type of non-small cell lung cancer cells and a novel candidate biomarker or therapeutic target for KRAS mutant non-small cell lung cancer.
24896341 Results indicate that cellular repressor of E1A-stimulated gene 1 protein (CREG1) increases endothelial cell (EC) filopodia formation.
24018888 The results suggest a novel role of CREG to promote HUVEC proliferation through the ERK/cyclin E signaling pathway.
23580165 CREG can inhibit NF-kappaB activation, TNF-alpha-induced inflammatory responses and the hyperpermeability of endothelial cells.
23518389 miR-31 not only directly binds to its target gene CREG and modulates the vascular smooth muscle cells(VSMC) phenotype through this interaction, but also can be an important biomarker in diseases involving VSMC phenotypic modulation.
23040447 Suggest that CREG is a novel adventitial fibroblast phenotypic modulator in a p38MAPK-dependent manner.
21939655 Upregulation of CREG expression induced HUVEC migration.
21872252 CREG plays a critical role in protecting the vascular endothelium from apoptosis, and the protective effort of CREG against ECs apoptosis is through the activation of the VEGF/PI3K/AKT signaling pathway
21263217 Cooperation of CREG1 and p16 (INK4a) inhibits the expression of cyclin A and cyclin B by inhibiting promoter activity thereby decreasing mRNA and protein levels; these proteins are required for S-phase entry and G2/M transition.
21195083 Data suggest that soluble CREG protein can exert its biological function via glycosylation-independent binding to the extracellular domains 11-13 of cell surface M6P/IGF2R, modulating SMC phenotypic switching from contractile to proliferative.
More...

AA Sequence

MAGLSRGSARALLAALLASTLLALLVSPARGRGGRDHGDWDEASRLPPLPPREDAARVARFVTHVSDWGA      1 - 70
LATISTLEAVRGRPFADVLSLSDGPPGAGSGVPYFYLSPLQLSVSNLQENPYATLTMTLAQTNFCKKHGF     71 - 140
DPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWVLDYFGGPKIVT    141 - 210
PEEYYNVTVQ                                                                211 - 220
//

Text Mined References (35)

PMID Year Title
26722374 2016 Glycoproteomic Approach Identifies KRAS as a Positive Regulator of CREG1 in Non-small Cell Lung Cancer Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
24896341 2014 CREG1 promotes angiogenesis and neovascularization.
24018888 2013 CREG promotes the proliferation of human umbilical vein endothelial cells through the ERK/cyclin E signaling pathway.
23580165 2013 Cellular repressor of E1A stimulated genes enhances endothelial monolayer integrity.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23518389 2013 MicroRNA-31 controls phenotypic modulation of human vascular smooth muscle cells by regulating its target gene cellular repressor of E1A-stimulated genes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23040447 2012 Cellular repressor E1A-stimulated genes controls phenotypic switching of adventitial fibroblasts by blocking p38MAPK activation.
More...