Property Summary

NCBI Gene PubMed Count 33
PubMed Score 116.90
PubTator Score 41.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.526 1.3e-05
adrenocortical carcinoma -1.224 1.5e-04
Atopic dermatitis -1.100 1.4e-04
diabetes mellitus -1.200 9.6e-03
malignant mesothelioma -1.600 2.5e-07
Multiple myeloma 2.009 2.3e-04
ovarian cancer -1.100 2.9e-03

Gene RIF (20)

AA Sequence

MAGLSRGSARALLAALLASTLLALLVSPARGRGGRDHGDWDEASRLPPLPPREDAARVARFVTHVSDWGA      1 - 70
LATISTLEAVRGRPFADVLSLSDGPPGAGSGVPYFYLSPLQLSVSNLQENPYATLTMTLAQTNFCKKHGF     71 - 140
DPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWVLDYFGGPKIVT    141 - 210
PEEYYNVTVQ                                                                211 - 220
//

Text Mined References (35)

PMID Year Title