Property Summary

NCBI Gene PubMed Count 9
Grant Count 71
R01 Count 49
Funding $11,207,071.74
PubMed Score 1012.64
PubTator Score 17.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Synonym

Accession O75628 E1P5L1 Q5TZR7 Q5TZR8 Q9NP57
Symbols GES
GD:REM

Gene

PDB

2NZJ  

Gene RIF (2)

PMID Text
17686775 a role for the Rem C terminus in plasma membrane localization through association with phosphatidylinositol lipids.
16648185 We conclude that Rem is capable of regulating L-type current, that release of Rem block is modulated by cellular kinase pathways, and that the Ca(V)1.2 COOH terminus contributes to Rem-dependent channel inhibition.

AA Sequence

MTLNTEQEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSES      1 - 70
SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERTLTVDGEDTTLVVVDTWEAEK     71 - 140
LDKSWSQESCLQGGSAYVIVYSIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSVEEG    141 - 210
RACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRRDSAAKEPPAPRRPASLAQRARRFLARLTARSA    211 - 280
RRRALKARSKSCHNLAVL                                                        281 - 298
//

Text Mined References (10)

PMID Year Title
22076634 2012 Adrenergic signaling controls RGK-dependent trafficking of cardiac voltage-gated L-type Ca2+ channels through PKD1.
17686775 2007 Plasma membrane targeting is essential for Rem-mediated Ca2+ channel inhibition.
16648185 2006 L-type calcium channel alpha-subunit and protein kinase inhibitors modulate Rem-mediated regulation of current.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623965 2003 Regulation of voltage-gated calcium channel activity by the Rem and Rad GTPases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10831614 2000 Ges, A human GTPase of the Rad/Gem/Kir family, promotes endothelial cell sprouting and cytoskeleton reorganization.
10441394 1999 Phosphorylation-dependent association of the Ras-related GTP-binding protein Rem with 14-3-3 proteins.