Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1090.33
PubTator Score 17.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 4.731 2.4
Gastritis 47 4.158 2.1
Gastroparesis 22 3.744 1.9

Expression

Gene RIF (2)

AA Sequence

MTLNTEQEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSES      1 - 70
SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERTLTVDGEDTTLVVVDTWEAEK     71 - 140
LDKSWSQESCLQGGSAYVIVYSIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSVEEG    141 - 210
RACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRRDSAAKEPPAPRRPASLAQRARRFLARLTARSA    211 - 280
RRRALKARSKSCHNLAVL                                                        281 - 298
//

Text Mined References (10)

PMID Year Title