Property Summary

NCBI Gene PubMed Count 118
Grant Count 203
R01 Count 144
Funding $23,623,415.93
PubMed Score 314.97
PubTator Score 236.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
ulcerative colitis 2.200 0.000
gastric cancer 1.700 0.001
pancreatic cancer 1.400 0.001
psoriasis 1.900 0.006
osteosarcoma 1.181 0.000
glioblastoma 1.100 0.000
cystic fibrosis 2.464 0.000
primary pancreatic ductal adenocarcinoma 1.456 0.001
adult high grade glioma 1.300 0.001
pilocytic astrocytoma 1.200 0.000
primary Sjogren syndrome 1.700 0.001
pancreatic carcinoma 1.100 0.027
lung carcinoma -1.400 0.000
spina bifida -1.297 0.040
mucosa-associated lymphoid tissue lympho... 1.740 0.020
invasive ductal carcinoma 1.200 0.028
acute myeloid leukemia 2.300 0.050
ovarian cancer 1.500 0.034

Synonym

Accession O75626 B2REA6 E1P5E0 Q86WM7
Symbols BLIMP1
PRDI-BF1

Gene

PDB

3DAL  

 GO Component (2)

Gene RIF (108)

PMID Text
26530011 The interaction between EBV-miR-BHRF1-2 and PRDM1 may be one of the mechanisms by which EBV-miRBHRF1-2 promotes Epstein-Barr virus lymphomagenesis.
26475096 Our findings suggest a previously unrecognized role of PRDM1 and human parvovirus B19 in the pathogenesis of Hashimoto thyroiditis
26431332 KLF4, together with BLIMP1, plays a critical role in mediating lytic Epstein-Barr virus reactivation in epithelial cells.
26310579 Blimp-1 regulates the transcription of CS1 gene in NK and B cell lines from multiple myeloma and diffuse large B cell lymphoma patients.
26221594 heterozygous deletion of 6q21 and/or PRDM1 was frequently detected in extranodal NK/T cell lymphoma, nasal type and correlated with downregulation of PRDM1.
26212250 Data show that vascular endothelial growth factor (VEGF) upregulates the transcription repressor PRD1-BF1 protein in endothelial cells.
26206802 Antineoplastic effects of liposomal short interfering RNA treatment targeting BLIMP1/PRDM1 in primary effusion lymphoma.
26146066 level of Blimp-1 mRNA in the monocytes from patients with active tuberculosis and latent tuberculosis infection subjects was down-regulated
26054109 peritoneal fluid mRNA level significantly elevated in endometriosis
25826676 Blimp-1 expression in dendritic cells can alter an innate inflammatory response by modulating the activation of myeloid cells
More...

AA Sequence

MLDICLEKRVGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSG      1 - 70
ADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYS     71 - 140
RGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHY    141 - 210
PYPGELTMMNLTQTQSSLKQPSTEKNELCPKNVPKREYSVKEILKLDSNPSKGKDLYRSNISPLTSEKDL    211 - 280
DDFRRRGSPEMPFYPRVVYPIRAPLPEDFLKASLAYGIERPTYITRSPIPSSTTPSPSARSSPDQSLKSS    281 - 350
SPHSSPGNTVSPVGPGSQEHRDSYAYLNASYGTEGLGSYPGYAPLPHLPPAFIPSYNAHYPKFLLPPYGM    351 - 420
NCNGLSAVSSMNGINNFGLFPRLCPVYSNLLGGGSLPHPMLNPTSLPSSLPSDGARRLLQPEHPREVLVP    421 - 490
APHSAFSFTGAAASMKDKACSPTSGSPTAGTAATAEHVVQPKATSAAMAAPSSDEAMNLIKNKRNMTGYK    491 - 560
TLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKP    561 - 630
HECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCSQCHKNYIHLC    631 - 700
SLKVHLKGNCAAAPAPGLPLEDLTRINEEIEKFDISDNADRLEDVEDDISVISVVEKEILAVVRKEKEET    701 - 770
GLKVSLQRNMGNGLLSSGCSLYESSDLPLMKLPPSNPLPLVPVKVKQETVEPMDP                   771 - 825
//

Text Mined References (122)

PMID Year Title
26530011 2016 EBV-miR-BHRF1-2 targets PRDM1/Blimp1: potential role in EBV lymphomagenesis.
26475096 2015 PRDM1 expression via human parvovirus B19 infection plays a role in the pathogenesis of Hashimoto thyroiditis.
26431332 2015 Differentiation-Dependent KLF4 Expression Promotes Lytic Epstein-Barr Virus Infection in Epithelial Cells.
26310579 2016 Blimp-1/PRDM1 regulates the transcription of human CS1 (SLAMF7) gene in NK and B cells.
26221594 2015 The Genetic Deletion of 6q21 and PRDM1 and Clinical Implications in Extranodal NK/T Cell Lymphoma, Nasal Type.
26212250 2015 VEGF-Mediated Induction of PRD1-BF1/Blimp1 Expression Sensitizes Tumor Vasculature to Oncolytic Virus Infection.
26206802 2015 Antineoplastic effects of liposomal short interfering RNA treatment targeting BLIMP1/PRDM1 in primary effusion lymphoma.
26146066 2015 [Down-regulated expression of Blimp-1 mRNA in monocytes from patients with active tuberculosis].
26054109 2015 Decreased Bcl-6 and increased Blimp-1 in the peritoneal cavity of patients with endometriosis.
25826676 2015 Expression of Blimp-1 in dendritic cells modulates the innate inflammatory response in dextran sodium sulfate-induced colitis.
More...