Property Summary

NCBI Gene PubMed Count 133
PubMed Score 345.88
PubTator Score 236.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
ulcerative colitis 2.200 2.3e-06
acute myeloid leukemia 2.300 5.0e-02
adult high grade glioma 1.300 1.2e-03
Astrocytoma, Pilocytic 1.200 2.2e-05
cystic fibrosis 2.464 7.1e-07
gastric cancer 1.700 5.5e-04
glioblastoma 1.100 1.8e-04
invasive ductal carcinoma 1.200 2.8e-02
lung carcinoma -1.400 4.8e-08
mucosa-associated lymphoid tissue lympho... 1.740 2.0e-02
osteosarcoma 1.181 7.8e-05
ovarian cancer 1.500 3.4e-02
pancreatic cancer 1.100 2.7e-02
pancreatic carcinoma 1.100 2.7e-02
primary pancreatic ductal adenocarcinoma 1.456 9.4e-04
primary Sjogren syndrome 1.700 1.0e-03
psoriasis 1.500 1.1e-12
spina bifida -1.297 4.0e-02

 GO Component (2)

Protein-protein Interaction (6)

Gene RIF (124)

AA Sequence

MLDICLEKRVGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSG      1 - 70
ADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYS     71 - 140
RGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHY    141 - 210
PYPGELTMMNLTQTQSSLKQPSTEKNELCPKNVPKREYSVKEILKLDSNPSKGKDLYRSNISPLTSEKDL    211 - 280
DDFRRRGSPEMPFYPRVVYPIRAPLPEDFLKASLAYGIERPTYITRSPIPSSTTPSPSARSSPDQSLKSS    281 - 350
SPHSSPGNTVSPVGPGSQEHRDSYAYLNASYGTEGLGSYPGYAPLPHLPPAFIPSYNAHYPKFLLPPYGM    351 - 420
NCNGLSAVSSMNGINNFGLFPRLCPVYSNLLGGGSLPHPMLNPTSLPSSLPSDGARRLLQPEHPREVLVP    421 - 490
APHSAFSFTGAAASMKDKACSPTSGSPTAGTAATAEHVVQPKATSAAMAAPSSDEAMNLIKNKRNMTGYK    491 - 560
TLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKP    561 - 630
HECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCSQCHKNYIHLC    631 - 700
SLKVHLKGNCAAAPAPGLPLEDLTRINEEIEKFDISDNADRLEDVEDDISVISVVEKEILAVVRKEKEET    701 - 770
GLKVSLQRNMGNGLLSSGCSLYESSDLPLMKLPPSNPLPLVPVKVKQETVEPMDP                   771 - 825
//

Text Mined References (138)

PMID Year Title