Property Summary

NCBI Gene PubMed Count 17
PubMed Score 233.44
PubTator Score 10.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 2.000 4.0e-02
COPD -1.100 1.3e-03
group 3 medulloblastoma 1.200 1.5e-02
intraductal papillary-mucinous adenoma (... -1.100 3.7e-03
intraductal papillary-mucinous carcinoma... -1.200 2.9e-03
osteosarcoma -1.441 5.6e-05
ovarian cancer 1.100 1.3e-03
psoriasis -1.100 4.6e-03

Gene RIF (5)

AA Sequence

MAGLKRRASQVWPEEHGEQEHGLYSLHRMFDIVGTHLTHRDVRVLSFLFVDVIDDHERGLIRNGRDFLLA      1 - 70
LERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEETSIRYVTPRALSDPEPRPPQ     71 - 140
PSKTVPPHYPVVCCPTSGPQMCSKRPARGRATLGSQRKRRKSVTPDPKEKQTCDIRLRVRAEYCQHETAL    141 - 210
QGNVFSNKQDPLERQFERFNQANTILKSRDLGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVFITDS    211 - 280
LKQAVGHEAIKLLVNVDEEDYELGRQKLLRNLMLQALP                                    281 - 318
//

Text Mined References (17)

PMID Year Title