Property Summary

NCBI Gene PubMed Count 16
Grant Count 9
R01 Count 8
Funding $2,162,320.83
PubMed Score 219.00
PubTator Score 10.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.800 0.000
osteosarcoma -1.441 0.000
intraductal papillary-mucinous adenoma (... -1.100 0.004
intraductal papillary-mucinous carcinoma... -1.200 0.003
Breast cancer 2.000 0.040
group 3 medulloblastoma 1.200 0.015
COPD -1.100 0.001
ovarian cancer 1.100 0.001

Gene RIF (4)

PMID Text
22719072 Via direct interaction with the class III PI-3-kinase (PI3KC3)/Beclin1, DEDD activated autophagy and induced the degradation of Snail and Twist, two master regulators of EMT
20070122 FAS-associated death domain (FADD)-DED-induced reactive oxygen species (ROS) generation is triggered by membrane localization of FADD-DED, which shifts the cells into a state that stimulates and fuels ROS and ultimately results in cell death.
12527898 DEDD and DEDD2 may be important mediators for death receptors and that they may target caspases to the nucleus.
11965497 DEDD forms nuclear complexes with the TFIIIC102 subunit of human transcription factor IIIC

AA Sequence

MAGLKRRASQVWPEEHGEQEHGLYSLHRMFDIVGTHLTHRDVRVLSFLFVDVIDDHERGLIRNGRDFLLA      1 - 70
LERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEETSIRYVTPRALSDPEPRPPQ     71 - 140
PSKTVPPHYPVVCCPTSGPQMCSKRPARGRATLGSQRKRRKSVTPDPKEKQTCDIRLRVRAEYCQHETAL    141 - 210
QGNVFSNKQDPLERQFERFNQANTILKSRDLGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVFITDS    211 - 280
LKQAVGHEAIKLLVNVDEEDYELGRQKLLRNLMLQALP                                    281 - 318
//

Text Mined References (16)

PMID Year Title
22719072 2012 DEDD interacts with PI3KC3 to activate autophagy and attenuate epithelial-mesenchymal transition in human breast cancer.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20070122 2010 Localization of the death effector domain of Fas-associated death domain protein into the membrane of Escherichia coli induces reactive oxygen species-involved cell death.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15688372 2005 Fas-associated factor-1 mediates chemotherapeutic-induced apoptosis via death effector filament formation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12527898 2003 DEDD and DEDD2 associate with caspase-8/10 and signal cell death.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...