Property Summary

NCBI Gene PubMed Count 14
PubMed Score 187.96
PubTator Score 5666.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.6e-04
lung cancer 4740 8.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.600 8.2e-04
psoriasis -2.100 3.6e-04

Protein-protein Interaction (5)

Gene RIF (3)

AA Sequence

MAAPSWRGARLVQSVLRVWQVGPHVARERVIPFSSLLGFQRRCVSCVAGSAFSGPRLASASRSNGQGSAL      1 - 70
DHFLGFSQPDSSVTPCVPAVSMNRDEQDVLLVHHPDMPENSRVLRVVLLGAPNAGKSTLSNQLLGRKVFP     71 - 140
VSRKVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKSMESADLVVVLVDVSDKW    141 - 210
TRNQLSPQLLRCLTKYSQIPSVLVMNKVDCLKQKSVLLELTAALTEGVVNGKKLKMRQAFHSHPGTHCPS    211 - 280
PAVKDPNTQSVGNPQRIGWPHFKEIFMLSALSQEDVKTLKQYLLTQAQPGPWEYHSAVLTSQTPEEICAN    281 - 350
IIREKLLEHLPQEVPYNVQQKTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM    351 - 420
DIFLCDVDIRLSVKLLK                                                         421 - 437
//

Text Mined References (19)

PMID Year Title