Property Summary

NCBI Gene PubMed Count 13
Grant Count 780
R01 Count 407
Funding $102,494,750.22
PubMed Score 179.26
PubTator Score 5666.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -2.100 0.000
lung cancer 1.600 0.001

Synonym

Accession O75616 B3KN21 C9JEC6 O75617 Q8WUY4 Q96LE2 Q96TC0 H-ERA
Symbols ERA
CEGA
ERA-W
H-ERA
ERAL1A
HERA-A
HERA-B

Gene

Gene RIF (1)

PMID Text
20604745 Data show that loss of ERAL1 leads to rapid decay of nascent 12S mt-rRNA, consistent with a role as a mitochondrial RNA chaperone.

AA Sequence

MAAPSWRGARLVQSVLRVWQVGPHVARERVIPFSSLLGFQRRCVSCVAGSAFSGPRLASASRSNGQGSAL      1 - 70
DHFLGFSQPDSSVTPCVPAVSMNRDEQDVLLVHHPDMPENSRVLRVVLLGAPNAGKSTLSNQLLGRKVFP     71 - 140
VSRKVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKSMESADLVVVLVDVSDKW    141 - 210
TRNQLSPQLLRCLTKYSQIPSVLVMNKVDCLKQKSVLLELTAALTEGVVNGKKLKMRQAFHSHPGTHCPS    211 - 280
PAVKDPNTQSVGNPQRIGWPHFKEIFMLSALSQEDVKTLKQYLLTQAQPGPWEYHSAVLTSQTPEEICAN    281 - 350
IIREKLLEHLPQEVPYNVQQKTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM    351 - 420
DIFLCDVDIRLSVKLLK                                                         421 - 437
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22576012 2012 Autophagy is induced through the ROS-TP53-DRAM1 pathway in response to mitochondrial protein synthesis inhibition.
21920408 2012 The role of TFAM-associated proteins in mitochondrial RNA metabolism.
21269460 2011 Initial characterization of the human central proteome.
20604745 2010 Human ERAL1 is a mitochondrial RNA chaperone involved in the assembly of the 28S small mitochondrial ribosomal subunit.
20430825 2010 ERAL1 is associated with mitochondrial ribosome and elimination of ERAL1 leads to mitochondrial dysfunction and growth retardation.
More...