Property Summary

NCBI Gene PubMed Count 20
PubMed Score 59.25
PubTator Score 18.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 0.000

Synonym

Accession O75610 B2R7U0 Q53H67 Q5TE94
Symbols LEFTB
LEFTYB

Gene

PANTHER Protein Class (2)

Gene RIF (13)

PMID Text
25339094 Lefty1 could regulates the cell cycle via modulating the expressions of P57 and cyclin D1 and then inhibit the decidualization in vitro.
23592333 The mRNA levels of LSD1 and beta-catenin are inversely correlated with the levels of Lefty1 in pancreas and breast tumors.
23407711 Reprogrammed cancer cells share the mechanism for expression of Lefty with induced pluripotent cancer cells (iPS), thus contributing to the cancerous transformation of iPS cells.
22441145 Data suggest that Lefty is a novel TGF-beta target molecule that mediates growth inhibition of pancreatic cancer cells.
21401636 Findings show that during embryonic development, EBAF/LEFTY B plays important roles in decidualization and embryo implantation.
21266536 Findings suggest that Lefty1 is negatively modulated by miR-302s in hESCs, which plays an important role in maintaining the balance between pluripotency and germ layer specification.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19874624 The expression of Nodal in normal and malignant endometrial cells that lack Lefty strongly supports an important role for this embryonic morphogen in the tissue remodelling events that occur across the menstrual cycle and in tumourogenesis.
More...

AA Sequence

MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHG      1 - 70
DRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRS     71 - 140
ARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGP    141 - 210
LASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAEN    211 - 280
WVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQK    281 - 350
CSCASDGALVPRRLQP                                                          351 - 366
//

Text Mined References (21)

PMID Year Title
25339094 2014 Lefty inhibits in vitro decidualization by regulating P57 and cyclin D1 expressions.
23592333 2013 Wnt3a-dependent and -independent protein interaction networks of chromatin-bound ?-catenin in mouse embryonic stem cells.
23407711 2013 Suppression of Lefty expression in induced pluripotent cancer cells.
22441145 2012 Transforming growth factor ? and Ras/MEK/ERK signaling regulate the expression level of a novel tumor suppressor Lefty.
21401636 2011 Isolation, characterization, and function of EBAF/LEFTY B: role in infertility.
21266536 2011 The Nodal inhibitor Lefty is negatively modulated by the microRNA miR-302 in human embryonic stem cells.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19874624 2009 Expression of nodal signalling components in cycling human endometrium and in endometrial cancer.
More...