Property Summary

NCBI Gene PubMed Count 20
PubMed Score 64.94
PubTator Score 18.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.2e-07
Disease Target Count Z-score Confidence
Visceral heterotaxy 14 4.157 2.1
Lung abscess 5 3.164 1.6
Kartagener Syndrome 38 3.025 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 1.2e-07

Protein-protein Interaction (3)

Gene RIF (13)

AA Sequence

MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHG      1 - 70
DRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRS     71 - 140
ARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGP    141 - 210
LASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAEN    211 - 280
WVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQK    281 - 350
CSCASDGALVPRRLQP                                                          351 - 366
//

Text Mined References (21)

PMID Year Title