Property Summary

Ligand Count 7
NCBI Gene PubMed Count 22
PubMed Score 68.77
PubTator Score 53.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.300 8.8e-04
breast carcinoma 1.100 4.4e-20
ductal carcinoma in situ 1.100 1.1e-02
glioblastoma 1.100 3.2e-05
hereditary spastic paraplegia -1.102 3.3e-02
intraductal papillary-mucinous adenoma (... 1.300 7.9e-03
intraductal papillary-mucinous carcinoma... 1.500 2.6e-03
intraductal papillary-mucinous neoplasm ... 1.400 2.3e-02
invasive ductal carcinoma 1.300 4.0e-02
lung adenocarcinoma 1.447 3.0e-03
lung cancer 1.600 9.9e-04
medulloblastoma, large-cell 1.800 2.9e-06
Multiple myeloma 1.098 7.0e-04
osteosarcoma 4.754 2.9e-09
ovarian cancer 2.600 2.6e-05
Pick disease 1.800 4.3e-08
primary Sjogren syndrome 1.100 1.7e-03
primitive neuroectodermal tumor 1.200 5.7e-06
psoriasis 1.200 8.7e-06
Rheumatoid arthritis 1.200 3.4e-02

Gene RIF (8)

AA Sequence

MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMP      1 - 70
SWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVT     71 - 140
ALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSS    141 - 210
CQQEMMDVKQFIDKLLPPID                                                      211 - 230
//

Text Mined References (25)

PMID Year Title