Property Summary

NCBI Gene PubMed Count 18
Grant Count 1
Funding $56,387
PubMed Score 6.99
PubTator Score 7.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.099 0.013
non-small cell lung cancer 1.578 0.000
lung cancer 2.600 0.000
colon cancer 1.100 0.004
atypical teratoid/rhabdoid tumor 1.100 0.001
psoriasis 1.100 0.000

Gene RIF (5)

PMID Text
22968912 Studies indicate that histone chalerones nucleoplasmin (NPM2/NPM3) preferentially associated with histones H2A-H2B in the egg and the nuclear autoantigenic sperm protein (NASP) families.
22362753 Characterization of the sperm chromatin decondensation and nucleosome assembly activities of homo- and hetero-oligomers of NPM1,NPM2 and NPM3.
22190034 HIV-1 Tat is identified to have a physical interaction with nucleophosmin/nucleoplasmin 3 (NPM3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20073534 NPM3 lacks intrinsic histone chaperone activity, inhibits histone assembly activity of NPM1 in vitro, and dramatically enhances transcription in a cellular system.
19710011 Acetylation of transition protein 2 (TP2) by KAT3B (p300) alters its DNA condensation property and interaction with putative histone chaperone NPM3.

AA Sequence

MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLC      1 - 70
LTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIV     71 - 140
TMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP                                    141 - 178
//

Text Mined References (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22968912 2012 Vertebrate nucleoplasmin and NASP: egg histone storage proteins with multiple chaperone activities.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22362753 2012 Function of homo- and hetero-oligomers of human nucleoplasmin/nucleophosmin family proteins NPM1, NPM2 and NPM3 during sperm chromatin remodeling.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
More...