Property Summary

NCBI Gene PubMed Count 42
Grant Count 12
R01 Count 8
Funding $769,283
PubMed Score 74.13
PubTator Score 45.32

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
927 confirmatory 64 / 551 / 59109 qHTS Assay for Inhibitors of Ubiquitin-specific Protease USP2a
1455 confirmatory 8 / 14 / 7 Confirmation Concentration-response Assay for Inhibitors of Ubiquitin-specific Protease USP2a
2281 summary 6 / 0 / 23 qHTS Assay for Inhibitors of Ubiquitin-specific Protease USP2a: Summary
463106 confirmatory 12 / 30 / 1238 qHTS Validation Assay for Inhibitors of Ubiquitin-specific Protease USP2a Using CHOP2 as the Reporter
463254 confirmatory 41 / 1472 / 329595 qHTS Assay for Inhibitors of Ubiquitin-specific Protease USP2a Using CHOP2 as the Reporter
493168 confirmatory 93 / 132 / 648 Confirmation Assay for Inhibitors of Ubiquitin-specific Protease USP2a Using CHOP2 as the Reporter
493170 confirmatory 162 / 142 / 569 Ub-rhodamine 110 based assay for inhibitors Ubiquitin-specific Protease USP2a
624345 other 0 / 0 / 3 Inhibitors of USP1/UAF1: Hit Validation in USP2 Diubiquiting Gel Assay
651626 other 0 / 0 / 1 Inhibitors of USP1/UAF1: SAR in USP2 diubiquitin SDS-PAGE gel assay
652172 confirmatory 24 / 1 / 3 Confirmation Assay for Inhibitors of Ubiquitin-specific Protease USP2a Using CHOP2 as the Reporter: K633
More...

Gene RIF (28)

PMID Text
26666640 Identify USP2 as a novel regulator of lipoprotein clearance owing to its ability to control ubiquitylation-dependent degradation of the LDLR by IDOL.
26250800 Our findings suggest that USP2a mRNA may be considered as a diagnostic marker candidate for bladder cancer, in particular, to stratify MIBC patients with a more invasive phenotype.
26033248 Modulation of USP-2 expression plays a crucial role in cell cycle regulation by leptin and adiponectin.
25888580 Data suggest up-regulation of ASAH1 (acid ceramidase) activity by androgen in androgen-sensitive prostate cancer cells (but not other cancer cells) is mainly due to prolonged stability of ASAH1 by androgen-stimulated induction of USP2 expression.
25687182 The present study showed that USP2 expression is associated with TNBC cell line's invasiveness and poor survival of breast cancer patients and may serve as a prognostic biomarker and therapeutic target for TNBC
25070846 findings demonstrated that USP2b deubiquitinates K63-linked polyubiquitin chains from TBK1 to terminate TBK1 activation and negatively regulate IFN-beta signaling and antiviral immune response.
24445145 Loss of USP2a expression is associated with glioblastoma.
24071644 USP2a increases intracellular glutathione content, thus interfering with the oxidative cascade triggered by chemotherapeutic agents.
23416128 USP2 and its substrate, fatty acid synthase (FASN), are over-expressed in glioma tissue.
23264041 USP2a plays an important role in TCR signaling by deSUMOylating TRAF6 and mediating TRAF6-MALT1 interaction
More...

AA Sequence

MSQLSSTLKRYTESARYTDAHYAKSGYGAYTPSSYGANLAASLLEKEKLGFKPVPTSSFLTRPRTYGPSS      1 - 70
LLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNNCLSYLPINAYDQGVTLTQKL     71 - 140
DSQSDLARDFSSLRTSDSYRIDPRNLGRSPMLARTRKELCTLQGLYQTASCPEYLVDYLENYGRKGSASQ    141 - 210
VPSQAPPSRVPEIISPTYRPIGRYTLWETGKGQAPGPSRSSSPGRDGMNSKSAQGLAGLRNLGNTCFMNS    211 - 280
ILQCLSNTRELRDYCLQRLYMRDLHHGSNAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRF    281 - 350
VGYNQQDAQEFLRFLLDGLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLK    351 - 420
SSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKFS    421 - 490
IQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAVYNLYAVSNHSGTTMGGHYTA    491 - 560
YCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELASPPSRM                             561 - 605
//

Text Mined References (44)

PMID Year Title
26666640 2016 The Deubiquitylase USP2 Regulates the LDLR Pathway by Counteracting the E3-Ubiquitin Ligase IDOL.
26250800 2015 Assess the expression of ubiquitin specific protease USP2a for bladder cancer diagnosis.
26033248 2015 Ubiquitin specific protease 2 acts as a key modulator for the regulation of cell cycle by adiponectin and leptin in cancer cells.
25888580 2015 Increased acid ceramidase expression depends on upregulation of androgen-dependent deubiquitinases, USP2, in a human prostate cancer cell line, LNCaP.
25687182 2015 USP2 promotes cell migration and invasion in triple negative breast cancer cell lines.
25416956 2014 A proteome-scale map of the human interactome network.
25070846 2014 Ubiquitin-specific protease 2b negatively regulates IFN-? production and antiviral activity by targeting TANK-binding kinase 1.
24445145 2014 Ubiquitin-specific protease 2a stabilizes MDM4 and facilitates the p53-mediated intrinsic apoptotic pathway in glioblastoma.
24071644 2013 USP2a alters chemotherapeutic response by modulating redox.
23416128 2013 Up-regulation of USP2a and FASN in gliomas correlates strongly with glioma grade.
More...