Property Summary

NCBI Gene PubMed Count 45
PubMed Score 84.86
PubTator Score 45.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease -1.343 4.1e-02
adrenocortical carcinoma -1.344 1.5e-02
adult high grade glioma -1.400 3.0e-03
aldosterone-producing adenoma -1.073 3.8e-02
Amyotrophic lateral sclerosis -1.170 1.1e-03
Atopic dermatitis -1.200 1.6e-04
atypical teratoid / rhabdoid tumor -2.200 4.4e-08
Breast cancer -1.100 1.5e-17
colon cancer -2.100 5.0e-07
glioblastoma -1.200 4.1e-04
hereditary spastic paraplegia 1.495 1.8e-02
intraductal papillary-mucinous adenoma (... -1.300 6.7e-05
intraductal papillary-mucinous carcinoma... -1.200 3.3e-04
intraductal papillary-mucinous neoplasm ... -1.300 1.5e-03
medulloblastoma -1.100 2.2e-02
ovarian cancer -1.300 1.6e-04
ulcerative colitis -1.400 1.8e-03

Gene RIF (31)

AA Sequence

MSQLSSTLKRYTESARYTDAHYAKSGYGAYTPSSYGANLAASLLEKEKLGFKPVPTSSFLTRPRTYGPSS      1 - 70
LLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNNCLSYLPINAYDQGVTLTQKL     71 - 140
DSQSDLARDFSSLRTSDSYRIDPRNLGRSPMLARTRKELCTLQGLYQTASCPEYLVDYLENYGRKGSASQ    141 - 210
VPSQAPPSRVPEIISPTYRPIGRYTLWETGKGQAPGPSRSSSPGRDGMNSKSAQGLAGLRNLGNTCFMNS    211 - 280
ILQCLSNTRELRDYCLQRLYMRDLHHGSNAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRF    281 - 350
VGYNQQDAQEFLRFLLDGLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLK    351 - 420
SSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKFS    421 - 490
IQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAVYNLYAVSNHSGTTMGGHYTA    491 - 560
YCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELASPPSRM                             561 - 605
//

Text Mined References (47)

PMID Year Title