Property Summary

NCBI Gene PubMed Count 8
PubMed Score 174.40
PubTator Score 29.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 3.97377613329192E-12
ependymoma 2514 2.19279545608014E-6
atypical teratoid / rhabdoid tumor 4369 3.61683855009741E-5
pediatric high grade glioma 2712 7.97913815191993E-5
glioblastoma 5572 1.0362458693927E-4
psoriasis 6685 7.99638329439372E-4
medulloblastoma 1524 9.34494460917544E-4
medulloblastoma, large-cell 6234 0.00175131529396033
primary Sjogren syndrome 789 0.00300323768979667
pancreatic cancer 2300 0.00319761921336046
primary pancreatic ductal adenocarcinoma 1271 0.00505450036937162
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0144224184984124
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0145876840624971
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0187141338051217

Expression

Synonym

Accession O75600 E2QC23 Q6ZWF1 Q96CA9 AKB ligase
Symbols KBL

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
12174908 effect of gene on proliferation arrest in a non-small cell bronchopulmonary cancer line.

AA Sequence

MWPGNAWRAALFWVPRGRRAQSALAQLRGILEGELEGIRGAGTWKSERVITSRQGPHIRVDGVSGGILNF      1 - 70
CANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQSIHKNLEAKIARFHQREDAILYPSCYDANAG     71 - 140
LFEALLTPEDAVLSDELNHASIIDGIRLCKAHKYRYRHLDMADLEAKLQEAQKHRLRLVATDGAFSMDGD    141 - 210
IAPLQEICCLASRYGALVFMDECHATGFLGPTGRGTDELLGVMDQVTIINSTLGKALGGASGGYTTGPGP    211 - 280
LVSLLRQRARPYLFSNSLPPAVVGCASKALDLLMGSNTIVQSMAAKTQRFRSKMEAAGFTISGASHPICP    281 - 350
VMLGDARLASRMADDMLKRGIFVIGFSYPVVPKGKARIRVQISAVHSEEDIDRCVEAFVEVGRLHGALP     351 - 419
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17688197 2007 Nuclear translocation of 2-amino-3-ketobutyrate coenzyme A ligase by cold and osmotic stress.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12174908 Effect of four genes (ALDH1, NRF1, JAM and KBL) on proliferation arrest in a non-small cell bronchopulmonary cancer line.
More...