Property Summary

NCBI Gene PubMed Count 8
PubMed Score 179.66
PubTator Score 29.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Protein-protein Interaction (4)

Gene RIF (2)

AA Sequence

MWPGNAWRAALFWVPRGRRAQSALAQLRGILEGELEGIRGAGTWKSERVITSRQGPHIRVDGVSGGILNF      1 - 70
CANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQSIHKNLEAKIARFHQREDAILYPSCYDANAG     71 - 140
LFEALLTPEDAVLSDELNHASIIDGIRLCKAHKYRYRHLDMADLEAKLQEAQKHRLRLVATDGAFSMDGD    141 - 210
IAPLQEICCLASRYGALVFMDECHATGFLGPTGRGTDELLGVMDQVTIINSTLGKALGGASGGYTTGPGP    211 - 280
LVSLLRQRARPYLFSNSLPPAVVGCASKALDLLMGSNTIVQSMAAKTQRFRSKMEAAGFTISGASHPICP    281 - 350
VMLGDARLASRMADDMLKRGIFVIGFSYPVVPKGKARIRVQISAVHSEEDIDRCVEAFVEVGRLHGALP     351 - 419
//

Text Mined References (13)

PMID Year Title