Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.35
PubTator Score 2.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 6.6e-101
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Q fever 15 3.529 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 8.500 6.6e-101

Gene RIF (2)

AA Sequence

MAKNGLVICILVITLLLDQTTSHTSRLKARKHSKRRVRDKDGDLKTQIEKLWTEVNALKEIQALQTVCLR      1 - 70
GTKVHKKCYLASEGLKHFHEANEDCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGK     71 - 140
FVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYICEFTIPQ                 141 - 197
//

Text Mined References (9)

PMID Year Title