Property Summary

NCBI Gene PubMed Count 8
Grant Count 136
R01 Count 100
Funding $18,921,215.48
PubMed Score 1.69
PubTator Score 2.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Q fever 11 3.51 1.8
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 8.500 0.000

Synonym

Accession O75596 B2R8C4 Q3SX91 Q6UXF5
Symbols CLECSF1

Gene

Gene RIF (2)

PMID Text
19844255 Observational study of gene-disease association. (HuGE Navigator)
19173304 CLEC3A binds to heparan sulfate proteoglycans on cell surface, leading to the enhancement of cell adhesion to integrin ligands on ECM; cleavage of CLEC3A by MMP-7 weakens the stable adhesion of tumor cells to the matrix

AA Sequence

MAKNGLVICILVITLLLDQTTSHTSRLKARKHSKRRVRDKDGDLKTQIEKLWTEVNALKEIQALQTVCLR      1 - 70
GTKVHKKCYLASEGLKHFHEANEDCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGK     71 - 140
FVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYICEFTIPQ                 141 - 197
//

Text Mined References (9)

PMID Year Title
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
19173304 2009 Matrilysin (MMP-7) cleaves C-type lectin domain family 3 member A (CLEC3A) on tumor cell surface and modulates its cell adhesion activity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10524194 1999 The cartilage-derived, C-type lectin (CLECSF1): structure of the gene and chromosomal location.