Property Summary

NCBI Gene PubMed Count 33
PubMed Score 250.27
PubTator Score 69.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Brain Injuries 65 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 1.1e-05
mucosa-associated lymphoid tissue lymphoma 484 2.6e-02

Expression

  Differential Expression (2)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 2.247 2.6e-02
osteosarcoma -3.493 1.1e-05

Gene RIF (22)

AA Sequence

MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTP      1 - 70
ASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVP     71 - 140
TPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP                  141 - 196
//

Text Mined References (33)

PMID Year Title