Property Summary

NCBI Gene PubMed Count 30
Grant Count 71
R01 Count 42
Funding $17,168,301.57
PubMed Score 230.89
PubTator Score 69.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -3.493 0.000
mucosa-associated lymphoid tissue lympho... 2.247 0.026

Synonym

Accession O75594 Q4VB36
Symbols PGRP
TAG7
PGRPS
PGLYRP
PGRP-S
TNFSF3L

Gene

PANTHER Protein Class (1)

PDB

1YCK  

Gene RIF (20)

PMID Text
26654597 Tag7-Mts1 complex causes chemotactic migration of lymphocytes, with NK cells being a preferred target.
26183779 Tag7, can bind to the TNFR1 receptor, thereby inhibiting the cytotoxic actions of the Tag7-Hsp70 complex and TNF-alpha, an acquired immunity cytokine.
25595774 The role for PGLYRP1 as a TREM-1 activator provides a new mechanism by which bacteria can trigger myeloid cells, linking two known, but previously unrelated, pathways in innate immunity.
25221852 The association study in a discovery sample of 200 French trio families revealed a significant association with rheumatoid arthritis for one SNP, PGLYRP1-rs2041992 (p = 0.019).
22037021 shown that HspBP1 binds Tag7 in the conditioned medium of tumor CSML0 cells, thereby preventing formation of the cytotoxic Tag7-Hsp70 complex
21984701 The PGRP-S promoter provides a useful reporter of M cell mucosal epithelium lineage commitment, corresponding to the expression of PGRP in M cells.
21247889 HspBP1 inhibited the cytotoxic activity of the Tag7-Hsp70 complex secreted by lymphocytes. HspBP1
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19666596 S100A4 has opposite roles in Tag7 and Hsp70- mediated tumoricidal mechanisms
More...

AA Sequence

MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTP      1 - 70
ASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVP     71 - 140
TPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP                  141 - 196
//

Text Mined References (31)

PMID Year Title
26654597 2015 A new role for PGRP-S (Tag7) in immune defense: lymphocyte migration is induced by a chemoattractant complex of Tag7 with Mts1.
26183779 2015 Tag7 (PGLYRP1) in Complex with Hsp70 Induces Alternative Cytotoxic Processes in Tumor Cells via TNFR1 Receptor.
25595774 2015 Cutting Edge: identification of neutrophil PGLYRP1 as a ligand for TREM-1.
25221852 2015 Relationship between SNPs and expression level for candidate genes in rheumatoid arthritis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22037021 2012 Extracellular HspBP1 inhibits formation of a cytotoxic Tag7-Hsp70 complex in vitro and in human serum.
21984701 2011 Convergent and divergent development among M cell lineages in mouse mucosal epithelium.
21247889 2011 The heat shock-binding protein (HspBP1) protects cells against the cytotoxic action of the Tag7-Hsp70 complex.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...