Property Summary

NCBI Gene PubMed Count 23
PubMed Score 8.38
PubTator Score 9.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.014
aldosterone-producing adenoma -1.142 0.032

Synonym

Accession O75586 B4DU17 B4E2P0 O15401 Q53FE3 Q53HJ3 Q6FHQ4 Q9BTH1 Q9UHL1
Symbols ARC33
NY-REN-28

Gene

Gene RIF (9)

PMID Text
25100719 Knockdown of MED6 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
25100719 Knockdown of mediator complex subunit 6 (MED6) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18976975 Knockdown of MED6 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of MED6 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of mediator complex subunit 6 (MED6) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18854154 Knockdown of MED6 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18854154 Knockdown of mediator complex subunit 6 (MED6) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 Knockdown of MED6 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18187620 Knockdown of mediator complex subunit 6 (MED6) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYIL      1 - 70
LHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYH     71 - 140
PSKGYWWHFKDHEEQDKVRPKAKRKEEPSSIFQRQRVDALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKE    141 - 210
AEPIPETVKPEEKETTKNVQQTVSAKGPPEKRMRLQ                                      211 - 246
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17641689 2007 MED25 is distinct from TRAP220/MED1 in cooperating with CBP for retinoid receptor activation.
17000779 2006 Mediator modulates Gli3-dependent Sonic hedgehog signaling.
16595664 2006 Human Mediator enhances basal transcription by facilitating recruitment of transcription factor IIB during preinitiation complex assembly.
16574658 2006 Regulation of Aurora-A kinase gene expression via GABP recruitment of TRAP220/MED1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...