Property Summary

NCBI Gene PubMed Count 78
Grant Count 45
R01 Count 33
Funding $2,118,148.1
PubMed Score 86.71
PubTator Score 76.38

Knowledge Summary

Patent (10,862)

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 2.800 0.000
osteosarcoma -3.391 0.000
glioblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -2.100 0.007
Amyotrophic Lateral Sclerosis 1.019 0.000
acute quadriplegic myopathy 1.207 0.000
tuberculosis and treatment for 3 months 1.200 0.001
lung cancer -1.100 0.002
active ulcerative colitis -1.209 0.025
diabetes mellitus -1.300 0.009
cystic fibrosis -1.400 0.000
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -1.700 0.001
subependymal giant cell astrocytoma -3.222 0.005
Endometriosis -1.048 0.011
Breast cancer -1.800 0.000
ovarian cancer -1.300 0.000
chronic rhinosinusitis -1.298 0.005

 GWAS Trait (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (41)

PMID Text
26109721 KSHV activates the MSK1/2-CREB1 pathway during primary infection and that it depends on this pathway for viral lytic replication. I
26030901 Interrupting MSK1 activation is a new target for antioxidants.
25958199 Increased MSK1 activity is critically important for Epstein-Barr virus LMP1-promoted cell proliferation and transformation.
25520509 Authors conclude that paramyxoviruses trigger the DNA damage response, a pathway required for MSK1 activation of phospho Ser 276 RelA formation to trigger the IRF7-RIG-I amplification loop necessary for mucosal interferon production.
24953041 These results highlight the relevance of MSK1 in the up-regulation of RARbeta by prostaglandin E2.
24792438 Data suggest that MSK1 and MSK2 are the major CREB kinases in fibroblast-like synoviocytes from rheumatoid arthritis patients stimulated with lysophosphatidic acid and that phosphorylation of CREB1 at Ser-133 plays a significant role in IL-8 production.
23675462 MSK1 and MSK2 are required for maximal TFF 1 induction.
23643942 Angiopoietin 2-mediated signaling via survivin/ref-1/MSK-1 pathway promotes doxorubicin resistance in HepG2 cells.
23604116 MSK1 plays an important role for hormone-dependent breast cancer growth
23047923 In vitro protein-protein interaction analysis identifies a Vpu-binding host protein ribosomal protein S6 kinase, 90kDa, polypeptide 5 (RPS6KA5, MSK1)
More...

AA Sequence

MEEEGGSSGGAAGTSADGGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAYGKVFLVRKIS      1 - 70
GHDTGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYAFQTETKLHLILDYINGGELF     71 - 140
THLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKLENILLDSNGHVVLTDFGLSKEFVADETERA    141 - 210
YSFCGTIEYMAPDIVRGGDSGHDKAVDWWSLGVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQ    211 - 280
EMSALAKDLIQRLLMKDPKKRLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAE    281 - 350
EFTEMDPTYSPAALPQSSEKLFQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFY    351 - 420
QHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEITALKLCEGHPNIVKLHEVFHD    421 - 490
QLHTFLVMELLNGGELFERIKKKKHFSETEASYIMRKLVSAVSHMHDVGVVHRDLKPENLLFTDENDNLE    491 - 560
IKIIDFGFARLKPPDNQPLKTPCFTLHYAAPELLNQNGYDESCDLWSLGVILYTMLSGQVPFQSHDRSLT    561 - 630
CTSAVEIMKKIKKGDFSFEGEAWKNVSQEAKDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSSNPLMT    631 - 700
PDILGSSGAAVHTCVKATFHAFNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTETRSSSSESSHSSSSHS    701 - 770
HGKTTPTKTLQPSNPADSNNPETLFQFSDSVA                                          771 - 802
//

Text Mined References (88)

PMID Year Title
26109721 2015 Screening of the Human Kinome Identifies MSK1/2-CREB1 as an Essential Pathway Mediating Kaposi's Sarcoma-Associated Herpesvirus Lytic Replication during Primary Infection.
26030901 2015 UVB Stimulates the Expression of Endothelin B Receptor in Human Melanocytes via a Sequential Activation of the p38/MSK1/CREB/MITF Pathway Which Can Be Interrupted by a French Maritime Pine Bark Extract through a Direct Inactivation of MSK1.
25958199 2015 Mitogen- and stress-activated Kinase 1 mediates Epstein-Barr virus latent membrane protein 1-promoted cell transformation in nasopharyngeal carcinoma through its induction of Fra-1 and c-Jun genes.
25520509 2015 Ataxia telangiectasia mutated kinase mediates NF-?B serine 276 phosphorylation and interferon expression via the IRF7-RIG-I amplification loop in paramyxovirus infection.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24953041 2014 Prostaglandin E2 induces retinoic acid receptor-? up-regulation through MSK1.
24792438 2014 Lysophosphatidic acid-induced IL-8 secretion involves MSK1 and MSK2 mediated activation of CREB1 in human fibroblast-like synoviocytes.
23675462 2013 Mitogen- and stress-activated protein kinases 1 and 2 are required for maximal trefoil factor 1 induction.
23643942 2013 Angiopoietin2 enhances doxorubin resistance in HepG2 cells by upregulating survivin and Ref-1 via MSK1 activation.
23604116 2014 Activation of mitogen- and stress-activated kinase 1 is required for proliferation of breast cancer cells in response to estrogens or progestins.
More...