Property Summary

Ligand Count 36
NCBI Gene PubMed Count 81
PubMed Score 92.61
PubTator Score 76.38

Knowledge Summary

Patent (10,862)


  Differential Expression (19)

Disease log2 FC p
active ulcerative colitis -1.209 2.5e-02
acute quadriplegic myopathy 1.207 8.0e-05
adult high grade glioma -1.900 6.5e-03
Amyotrophic lateral sclerosis 1.019 6.7e-06
Astrocytoma, Pilocytic -1.700 1.3e-03
atypical teratoid / rhabdoid tumor -2.200 3.8e-05
Breast cancer -1.800 7.8e-12
chronic rhinosinusitis -1.298 4.5e-03
cystic fibrosis -1.400 4.1e-04
diabetes mellitus -1.300 8.9e-03
Endometriosis -1.048 1.1e-02
glioblastoma -1.700 3.1e-05
lung cancer -1.100 2.4e-03
malignant mesothelioma 2.800 3.8e-08
medulloblastoma, large-cell -2.100 6.9e-03
osteosarcoma -2.238 1.3e-09
ovarian cancer -1.300 1.8e-04
subependymal giant cell astrocytoma -3.222 4.6e-03
tuberculosis and treatment for 3 months 1.200 1.0e-03

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (43)

AA Sequence

HGKTTPTKTLQPSNPADSNNPETLFQFSDSVA                                          771 - 802

Text Mined References (92)

PMID Year Title