Property Summary

NCBI Gene PubMed Count 78
PubMed Score 86.71
PubTator Score 76.38

Knowledge Summary

Patent (10,862)

TINX Plot

  Disease Sources (5)

Disease Target Count
Cocaine-Related Disorders 88
Disease Target Count P-value
Breast cancer 3099 7.79382619436293E-12
osteosarcoma 7933 2.05532652768595E-10
malignant mesothelioma 3163 3.75580349799773E-8
Amyotrophic Lateral Sclerosis 432 6.74428583308528E-6
atypical teratoid / rhabdoid tumor 4369 3.81933480090907E-5
acute quadriplegic myopathy 1157 7.96408400806178E-5
glioblastoma 5572 1.00082520850286E-4
ovarian cancer 8492 1.79860022094306E-4
pediatric high grade glioma 2712 2.0995794261223E-4
cystic fibrosis 1670 4.07140141462981E-4
tuberculosis and treatment for 3 months 327 0.00100323378651179
pilocytic astrocytoma 3086 0.00133250800484441
lung cancer 4473 0.00241360729070405
chronic rhinosinusitis 512 0.00450267181670657
subependymal giant cell astrocytoma 2287 0.00460180601653558
medulloblastoma, large-cell 6234 0.00685442718828005
diabetes mellitus 1663 0.00892805440441215
Endometriosis 535 0.0111243627256829
active ulcerative colitis 477 0.02461281071967
Disease Target Count Z-score Confidence
Osteoporosis 259 0.0 2.0
Disease Target Count Z-score Confidence
Coffin-Lowry syndrome 10 3.361 1.7

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 2.800 0.000
osteosarcoma -3.391 0.000
glioblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -2.100 0.007
Amyotrophic Lateral Sclerosis 1.019 0.000
acute quadriplegic myopathy 1.207 0.000
tuberculosis and treatment for 3 months 1.200 0.001
lung cancer -1.100 0.002
active ulcerative colitis -1.209 0.025
diabetes mellitus -1.300 0.009
cystic fibrosis -1.400 0.000
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -1.700 0.001
subependymal giant cell astrocytoma -3.222 0.005
Endometriosis -1.048 0.011
Breast cancer -1.800 0.000
ovarian cancer -1.300 0.000
chronic rhinosinusitis -1.298 0.005

Synonym

Accession O75582 B7Z2Y5 O95316 Q96AF7 S6K-alpha-5
Symbols MSK1
RLPK
MSPK1

Gene

PDB

1VZO   3KN5   3KN6  

  Ortholog (7)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 GWAS Trait (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (41)

PMID Text
26109721 KSHV activates the MSK1/2-CREB1 pathway during primary infection and that it depends on this pathway for viral lytic replication. I
26030901 Interrupting MSK1 activation is a new target for antioxidants.
25958199 Increased MSK1 activity is critically important for Epstein-Barr virus LMP1-promoted cell proliferation and transformation.
25520509 Authors conclude that paramyxoviruses trigger the DNA damage response, a pathway required for MSK1 activation of phospho Ser 276 RelA formation to trigger the IRF7-RIG-I amplification loop necessary for mucosal interferon production.
24953041 These results highlight the relevance of MSK1 in the up-regulation of RARbeta by prostaglandin E2.
24792438 Data suggest that MSK1 and MSK2 are the major CREB kinases in fibroblast-like synoviocytes from rheumatoid arthritis patients stimulated with lysophosphatidic acid and that phosphorylation of CREB1 at Ser-133 plays a significant role in IL-8 production.
23675462 MSK1 and MSK2 are required for maximal TFF 1 induction.
23643942 Angiopoietin 2-mediated signaling via survivin/ref-1/MSK-1 pathway promotes doxorubicin resistance in HepG2 cells.
23604116 MSK1 plays an important role for hormone-dependent breast cancer growth
23047923 In vitro protein-protein interaction analysis identifies a Vpu-binding host protein ribosomal protein S6 kinase, 90kDa, polypeptide 5 (RPS6KA5, MSK1)
More...

AA Sequence

MEEEGGSSGGAAGTSADGGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAYGKVFLVRKIS      1 - 70
GHDTGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYAFQTETKLHLILDYINGGELF     71 - 140
THLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKLENILLDSNGHVVLTDFGLSKEFVADETERA    141 - 210
YSFCGTIEYMAPDIVRGGDSGHDKAVDWWSLGVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQ    211 - 280
EMSALAKDLIQRLLMKDPKKRLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAE    281 - 350
EFTEMDPTYSPAALPQSSEKLFQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFY    351 - 420
QHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEITALKLCEGHPNIVKLHEVFHD    421 - 490
QLHTFLVMELLNGGELFERIKKKKHFSETEASYIMRKLVSAVSHMHDVGVVHRDLKPENLLFTDENDNLE    491 - 560
IKIIDFGFARLKPPDNQPLKTPCFTLHYAAPELLNQNGYDESCDLWSLGVILYTMLSGQVPFQSHDRSLT    561 - 630
CTSAVEIMKKIKKGDFSFEGEAWKNVSQEAKDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSSNPLMT    631 - 700
PDILGSSGAAVHTCVKATFHAFNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTETRSSSSESSHSSSSHS    701 - 770
HGKTTPTKTLQPSNPADSNNPETLFQFSDSVA                                          771 - 802
//

Text Mined References (88)

PMID Year Title
26109721 2015 Screening of the Human Kinome Identifies MSK1/2-CREB1 as an Essential Pathway Mediating Kaposi's Sarcoma-Associated Herpesvirus Lytic Replication during Primary Infection.
26030901 2015 UVB Stimulates the Expression of Endothelin B Receptor in Human Melanocytes via a Sequential Activation of the p38/MSK1/CREB/MITF Pathway Which Can Be Interrupted by a French Maritime Pine Bark Extract through a Direct Inactivation of MSK1.
25958199 2015 Mitogen- and stress-activated Kinase 1 mediates Epstein-Barr virus latent membrane protein 1-promoted cell transformation in nasopharyngeal carcinoma through its induction of Fra-1 and c-Jun genes.
25520509 2015 Ataxia telangiectasia mutated kinase mediates NF-?B serine 276 phosphorylation and interferon expression via the IRF7-RIG-I amplification loop in paramyxovirus infection.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24953041 2014 Prostaglandin E2 induces retinoic acid receptor-? up-regulation through MSK1.
24792438 2014 Lysophosphatidic acid-induced IL-8 secretion involves MSK1 and MSK2 mediated activation of CREB1 in human fibroblast-like synoviocytes.
23675462 2013 Mitogen- and stress-activated protein kinases 1 and 2 are required for maximal trefoil factor 1 induction.
23643942 2013 Angiopoietin2 enhances doxorubin resistance in HepG2 cells by upregulating survivin and Ref-1 via MSK1 activation.
23604116 2014 Activation of mitogen- and stress-activated kinase 1 is required for proliferation of breast cancer cells in response to estrogens or progestins.
More...