Property Summary

NCBI Gene PubMed Count 180
PubMed Score 273.25
PubTator Score 175.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Tooth agenesis 44

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia -1.800 3.4e-02
adrenocortical carcinoma 1.156 3.5e-03
astrocytic glioma 1.100 1.2e-02
atypical teratoid / rhabdoid tumor 1.700 1.9e-05
glioblastoma 1.400 1.6e-05
group 3 medulloblastoma 1.100 9.1e-03
hereditary spastic paraplegia -1.041 1.1e-02
lung cancer 1.400 1.1e-04
medulloblastoma, large-cell 1.200 1.6e-04
osteosarcoma 3.031 2.2e-07
Pick disease -1.300 7.3e-04
posterior fossa group A ependymoma 1.100 2.9e-07
primitive neuroectodermal tumor 1.200 2.7e-03
progressive supranuclear palsy -1.500 1.5e-02

Protein-protein Interaction (9)

PDB (14)

Gene RIF (146)

AA Sequence

MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDV      1 - 70
SEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQP     71 - 140
RAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSN    141 - 210
LDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQP    211 - 280
NATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFT    281 - 350
DIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT    351 - 420
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLG    421 - 490
WPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHK    491 - 560
RSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVP    561 - 630
EAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVV    631 - 700
EFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGK    701 - 770
PKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ    771 - 840
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVG    841 - 910
GFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLY    911 - 980
WIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSVGV    981 - 1050
VLKGEQDRPRAVVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWAD   1051 - 1120
SDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSD   1121 - 1190
IHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGE   1191 - 1260
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQ   1261 - 1330
FRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTVYFICQRMLCP   1331 - 1400
RMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASS   1401 - 1470
SSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSD   1471 - 1540
YAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCT   1541 - 1610
DSS                                                                      1611 - 1613
//

Text Mined References (186)

PMID Year Title