Property Summary

NCBI Gene PubMed Count 162
Grant Count 202
R01 Count 142
Funding $20,762,894.87
PubMed Score 249.07
PubTator Score 175.34

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O75581 Q17RZ2 LRP-6
Symbols ADCAD2
STHAG7

Gene

PDB

3S2K   3S8V   3SOQ   5FWW   4NM5   4NM7   3S8Z   3S94   3SOB   3SOV   4A0P   4DG6   5AIR  

Gene RIF (133)

PMID Text
26797284 Accordingly, we propose that the anti-fibrotic activity of adiponectin may be mediated through AdipoR1/R2 receptors
26387593 Loss-of-Function Mutations in the WNT Co-receptor LRP6 Cause Autosomal-Dominant Oligodontia.
26239517 Results suggest that miR-126 functions as a tumor-suppressive miRNA by targeting LRP6 regulating Wnt/beta-catenin signaling pathway in papillary thyroid carcinoma.
26120271 LRP6 and VEGF levels in the vitreous body from patients with proliferative diabetic retinopathy were increased and correlated mutually.
26063413 miR513c functions as a tumor suppressor miRNA, mediated predominantly through the direct suppression of the expression of LRP6.
26031789 LRP6 variants may be associated with risk of ischaemic stroke.
25959626 findings suggest that rescuing LRP5/6-mediated Wnt signaling improves neuronal cell survival and reduces tau phosphorylation, which support the hypothesis that Wnt signaling might be an attractive therapeutic strategy for managing AD
25902418 Lrp6 binds to Frizzled, preventing Frz-regulated non-canonical Wnt pathway activation and further non-canonical pathway-mediated tumour metastasis.
25783012 No mutations in LRP5 and LRP6 could be identified
25546815 LRP6 variants outside of YWTD repeats could potentially predispose embryos to neural tube defectss, whereas Lrp6 modulation of Wnt/planar cell polarity signaling would be more essential than its canonical pathway role in neural tube closure.
More...

AA Sequence

MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDV      1 - 70
SEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQP     71 - 140
RAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSN    141 - 210
LDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQP    211 - 280
NATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFT    281 - 350
DIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT    351 - 420
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLG    421 - 490
WPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHK    491 - 560
RSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVP    561 - 630
EAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVV    631 - 700
EFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGK    701 - 770
PKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ    771 - 840
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVG    841 - 910
GFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLY    911 - 980
WIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSVGV    981 - 1050
VLKGEQDRPRAVVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWAD   1051 - 1120
SDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSD   1121 - 1190
IHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGE   1191 - 1260
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQ   1261 - 1330
FRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTVYFICQRMLCP   1331 - 1400
RMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASS   1401 - 1470
SSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSD   1471 - 1540
YAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCT   1541 - 1610
DSS                                                                      1611 - 1613
//

Text Mined References (167)

PMID Year Title
27013965 2016 Protective LRRK2 R1398H Variant Enhances GTPase and Wnt Signaling Activity.
26797284 2016 Adiponectin inhibits Wnt co-receptor, Lrp6, phosphorylation and ?-catenin signaling.
26387593 2015 Loss-of-Function Mutations in the WNT Co-receptor LRP6 Cause Autosomal-Dominant Oligodontia.
26239517 2015 miR-126 inhibits papillary thyroid carcinoma growth by targeting LRP6.
26120271 2015 Elevated LRP6 levels correlate with vascular endothelial growth factor in the vitreous of proliferative diabetic retinopathy.
26063413 2015 microRNA-513c suppresses the proliferation of human glioblastoma cells by repressing low-density lipoprotein receptor-related protein 6.
26031789 2015 Low density lipoprotein receptor related protein 1 and 6 gene variants and ischaemic stroke risk.
25959626 2015 Wnt co-receptor LRP5/6 overexpression confers protection against hydrogen peroxide-induced neurotoxicity and reduces tau phosphorylation in SH-SY5Y cells.
25902418 2015 LRP5/6 directly bind to Frizzled and prevent Frizzled-regulated tumour metastasis.
25783012 2015 Idiopathic Juvenile Osteoporosis: Clinical Experience from a Single Centre and Screening of LRP5 and LRP6 Genes.
More...