Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.29
PubTator Score 11.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Expression

  Differential Expression (1)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.400 0.000

Synonym

Accession O75578 B2RAM4 B2RTV5 Q6UXJ6 Q9UHZ8
Symbols PRO827

Gene

Gene RIF (2)

PMID Text
16684505 Analyses of the functional regulatory domains of the integrin alpha 10 promoter suggest that AP-2epsilon and Ets-1 are involved in the transcriptional regulation of this gene in chondrocytes.
11731273 Mouse and human articular chondrocytes express extracellular splice variants of the alpha10 subunit

AA Sequence

MELPFVTHLFLPLVFLTGLCSPFNLDEHHPRLFPGPPEAEFGYSVLQHVGGGQRWMLVGAPWDGPSGDRR      1 - 70
GDVYRCPVGGAHNAPCAKGHLGDYQLGNSSHPAVNMHLGMSLLETDGDGGFMACAPLWSRACGSSVFSSG     71 - 140
ICARVDASFQPQGSLAPTAQRCPTYMDVVIVLDGSNSIYPWSEVQTFLRRLVGKLFIDPEQIQVGLVQYG    141 - 210
ESPVHEWSLGDFRTKEEVVRAAKNLSRREGRETKTAQAIMVACTEGFSQSHGGRPEAARLLVVVTDGESH    211 - 280
DGEELPAALKACEAGRVTRYGIAVLGHYLRRQRDPSSFLREIRTIASDPDERFFFNVTDEAALTDIVDAL    281 - 350
GDRIFGLEGSHAENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWLEGGHRLFPPRMALEDEF    351 - 420
PPALQNHAAYLGYSVSSMLLRGGRRLFLSGAPRFRHRGKVIAFQLKKDGAVRVAQSLQGEQIGSYFGSEL    421 - 490
CPLDTDRDGTTDVLLVAAPMFLGPQNKETGRVYVYLVGQQSLLTLQGTLQPEPPQDARFGFAMGALPDLN    491 - 560
QDGFADVAVGAPLEDGHQGALYLYHGTQSGVRPHPAQRIAAASMPHALSYFGRSVDGRLDLDGDDLVDVA    561 - 630
VGAQGAAILLSSRPIVHLTPSLEVTPQAISVVQRDCRRRGQEAVCLTAALCFQVTSRTPGRWDHQFYMRF    631 - 700
TASLDEWTAGARAAFDGSGQRLSPRRLRLSVGNVTCEQLHFHVLDTSDYLRPVALTVTFALDNTTKPGPV    701 - 770
LNEGSPTSIQKLVPFSKDCGPDNECVTDLVLQVNMDIRGSRKAPFVVRGGRRKVLVSTTLENRKENAYNT    771 - 840
SLSLIFSRNLHLASLTPQRESPIKVECAAPSAHARLCSVGHPVFQTGAKVTFLLEFEFSCSSLLSQVFVK    841 - 910
LTASSDSLERNGTLQDNTAQTSAYIQYEPHLLFSSESTLHRYEVHPYGTLPVGPGPEFKTTLRVQNLGCY    911 - 980
VVSGLIISALLPAVAHGGNYFLSLSQVITNNASCIVQNLTEPPGPPVHPEELQHTNRLNGSNTQCQVVRC    981 - 1050
HLGQLAKGTEVSVGLLRLVHNEFFRRAKFKSLTVVSTFELGTEEGSVLQLTEASRWSESLLEVVQTRPIL   1051 - 1120
ISLWILIGSVLGGLLLLALLVFCLWKLGFFAHKKIPEEEKREEKLEQ                          1121 - 1167
//

Text Mined References (19)

PMID Year Title
25406351 2015 Epigenetic and in vivo comparison of diverse MSC sources reveals an endochondral signature for human hematopoietic niche formation.
24823363 2014 Citrullination of collagen II affects integrin-mediated cell adhesion in a receptor-specific manner.
22189006 2012 Integrin genes and susceptibility to human melanoma.
22122519 2012 Cigarette smoke extract induces select matrix metalloproteinases and integrin expression in periodontal ligament fibroblasts.
22024737 2012 Short-term weightlessness produced by parabolic flight maneuvers altered gene expression patterns in human endothelial cells.
18047418 2007 Alpha10 integrin expression is up-regulated on fibroblast growth factor-2-treated mesenchymal stem cells with improved chondrogenic differentiation potential.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16684505 2006 Regulation of integrin alpha10 expression in chondrocytes by the transcription factors AP-2epsilon and Ets-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383545 2004 The fibril-associated collagen IX provides a novel mechanism for cell adhesion to cartilaginous matrix.
More...