Property Summary

NCBI Gene PubMed Count 29
PubMed Score 80.55
PubTator Score 179.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 3.4e-04
spina bifida 1074 4.0e-02
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 1.1

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.110 3.4e-04
spina bifida -1.473 4.0e-02

Protein-protein Interaction (1)

Gene RIF (13)

AA Sequence

MEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFL      1 - 70
TALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNV     71 - 140
AMDEEDPA                                                                  141 - 148
//

Text Mined References (31)

PMID Year Title