Property Summary

NCBI Gene PubMed Count 27
Grant Count 15
R01 Count 4
Funding $9,539,663.59
PubMed Score 72.25
PubTator Score 179.12

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.110 0.000
spina bifida -1.473 0.040

Gene RIF (11)

PMID Text
25015815 In this review, the influence of the CGRP family peptides in reproduction and pregnancy is explored and discussed.
22074408 This study demonstrates the detailed expression of CGRP and its receptor components within spinal trigeminal nucleus in the brainstem and in the spinal cord at C1-level
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20099900 The extracellular protein domains corresponding to residues 23-133 of calcitonin receptor-like receptor and residues 26-117 of receptor activity-modifying protein 1 (RAMP1) are shown to be sufficient for formation of a stable, folded monodisperse complex.
19913063 Data describe the role of residues 23-60 of the calcitonin receptor-like receptor in binding with interaction sites within the N-terminus of the calcitonin gene-related peptide receptor.
19053766 analysis of the effects of antagonists to the CGRP receptor
18636754 A peptide mimetic demonstrates that 12 residues of family B member CGRP receptor proximal C-terminus are required for this receptor's expression and localization at the cell membrane.
17853344 Increased mRNA expression CGRP-RCP in gravid myometrium supports the possibility of involvement of CGRP in the control of myometrial contractility.
16406141 inhibition of ACE seems to augment CGRP catabolism.
12482973 human CGRP-RCP is the genuine orthologue of C17. CGRP-RCP was found to functionally replace C17 in Deltarpc17 yeast cells; CGRP-RCP was identified in a purified human Pol III preparation.
More...

AA Sequence

MEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFL      1 - 70
TALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNV     71 - 140
AMDEEDPA                                                                  141 - 148
//

Text Mined References (29)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25015815 2014 Calcitonin gene related family peptides: importance in normal placental and fetal development.
22074408 2011 Calcitonin gene-related peptide (CGRP) and its receptor components in human and rat spinal trigeminal nucleus and spinal cord at C1-level.
21223598 2011 Genome-wide joint SNP and CNV analysis of aortic root diameter in African Americans: the HyperGEN study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20099900 2010 Refolding and characterization of a soluble ectodomain complex of the calcitonin gene-related peptide receptor.
19913063 2010 Mapping interaction sites within the N-terminus of the calcitonin gene-related peptide receptor; the role of residues 23-60 of the calcitonin receptor-like receptor.
19053766 2008 Identification of potent, selective, and metabolically stable peptide antagonists to the calcitonin gene-related peptide (CGRP) receptor.
18636754 2008 Functional and biophysical analysis of the C-terminus of the CGRP-receptor; a family B GPCR.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...