Property Summary

NCBI Gene PubMed Count 27
PubMed Score 72.25
PubTator Score 179.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
osteosarcoma 7933 3.41893951546987E-4
spina bifida 1064 0.0401937492659501
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 1.0
Disease Target Count Z-score Confidence
Cardiac arrest 26 3.237 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.110 0.000
spina bifida -1.473 0.040

Synonym

Accession O75575 A8MUZ4 A8MW23 B2R4H4 B4E198 Q3KRA3 Q5HYF1 Q8IXL4 RNA polymerase III subunit C9
Symbols RCP
RCP9
CGRPRCP
CGRP-RCP

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA Inparanoid

Gene RIF (11)

PMID Text
25015815 In this review, the influence of the CGRP family peptides in reproduction and pregnancy is explored and discussed.
22074408 This study demonstrates the detailed expression of CGRP and its receptor components within spinal trigeminal nucleus in the brainstem and in the spinal cord at C1-level
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20099900 The extracellular protein domains corresponding to residues 23-133 of calcitonin receptor-like receptor and residues 26-117 of receptor activity-modifying protein 1 (RAMP1) are shown to be sufficient for formation of a stable, folded monodisperse complex.
19913063 Data describe the role of residues 23-60 of the calcitonin receptor-like receptor in binding with interaction sites within the N-terminus of the calcitonin gene-related peptide receptor.
19053766 analysis of the effects of antagonists to the CGRP receptor
18636754 A peptide mimetic demonstrates that 12 residues of family B member CGRP receptor proximal C-terminus are required for this receptor's expression and localization at the cell membrane.
17853344 Increased mRNA expression CGRP-RCP in gravid myometrium supports the possibility of involvement of CGRP in the control of myometrial contractility.
16406141 inhibition of ACE seems to augment CGRP catabolism.
12482973 human CGRP-RCP is the genuine orthologue of C17. CGRP-RCP was found to functionally replace C17 in Deltarpc17 yeast cells; CGRP-RCP was identified in a purified human Pol III preparation.
More...

AA Sequence

MEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFL      1 - 70
TALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNV     71 - 140
AMDEEDPA                                                                  141 - 148
//

Text Mined References (29)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25015815 2014 Calcitonin gene related family peptides: importance in normal placental and fetal development.
22074408 2011 Calcitonin gene-related peptide (CGRP) and its receptor components in human and rat spinal trigeminal nucleus and spinal cord at C1-level.
21223598 2011 Genome-wide joint SNP and CNV analysis of aortic root diameter in African Americans: the HyperGEN study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20099900 2010 Refolding and characterization of a soluble ectodomain complex of the calcitonin gene-related peptide receptor.
19913063 2010 Mapping interaction sites within the N-terminus of the calcitonin gene-related peptide receptor; the role of residues 23-60 of the calcitonin receptor-like receptor.
19053766 2008 Identification of potent, selective, and metabolically stable peptide antagonists to the calcitonin gene-related peptide (CGRP) receptor.
18636754 2008 Functional and biophysical analysis of the C-terminus of the CGRP-receptor; a family B GPCR.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...