Property Summary

NCBI Gene PubMed Count 10
Grant Count 27
R01 Count 19
Funding $3,709,595.21
PubMed Score 6.94
PubTator Score 103.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.600 0.001
osteosarcoma -3.275 0.000
intraductal papillary-mucinous neoplasm ... 1.700 0.005
ovarian cancer -1.200 0.000

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
17803939 Purified mtRF1 did not induce translation termination in vitro nor did mtRF1 restore mitochondrial translation machinery in mutated S. cerevisiae in vivo. A different mtRF, mtRF1a, was found.

AA Sequence

MNRHLCVWLFRHPSLNGYLQCHIQLHSHQFRQIHLDTRLQVFRQNRNCILHLLSKNWSRRYCHQDTKMLW      1 - 70
KHKALQKYMENLSKEYQTLEQCLQHIPVNEENRRSLNRRHAELAPLAAIYQEIQETEQAIEELESMCKSL     71 - 140
NKQDEKQLQELALEERQTIDQKINMLYNELFQSLVPKEKYDKNDVILEVTAGRTTGGDICQQFTREIFDM    141 - 210
YQNYSCYKHWQFELLNYTPADYGGLHHAAARISGDGVYKHLKYEGGIHRVQRIPEVGLSSRMQRIHTGTM    211 - 280
SVIVLPQPDEVDVKLDPKDLRIDTFRAKGAGGQHVNKTDSAVRLVHIPTGLVVECQQERSQIKNKEIAFR    281 - 350
VLRARLYQQIIEKDKRQQQSARKLQVGTRAQSERIRTYNFTQDRVSDHRIAYEVRDIKEFLCGGKGLDQL    351 - 420
IQRLLQSADEEAIAELLDEHLKSAK                                                 421 - 445
//

Text Mined References (10)

PMID Year Title
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20598281 2010 Mutations in C12orf65 in patients with encephalomyopathy and a mitochondrial translation defect.
18429816 2008 HMRF1L is a human mitochondrial translation release factor involved in the decoding of the termination codons UAA and UAG.
17803939 2007 mtRF1a is a human mitochondrial translation release factor decoding the major termination codons UAA and UAG.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10773675 2000 Assignment of the human mitochondrial translational release factor 1 (MTRF1) to chromosome 13q14.1-->q14.3 and of the human mitochondrial ribosome recycling factor (MRRF) to chromosome 9q32-->q34.1 with radiation hybrid mapping.
9838146 1998 Identification and cloning of human mitochondrial translational release factor 1 and the ribosome recycling factor.