Property Summary

NCBI Gene PubMed Count 73
PubMed Score 32.13
PubTator Score 52.89

Knowledge Summary

Patent (12,843)

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
ovarian cancer 8492 1.37307371682523E-11
psoriasis 6685 1.30955271531133E-10
Pick disease 1893 1.87657502153048E-6
hepatocellular carcinoma 550 4.20668877139565E-5
pancreatic carcinoma 567 0.00598801846061895
pancreatic cancer 2300 0.00598801846061896
Multiple myeloma 1328 0.00979720432974848
ependymoma 2514 0.0126584810201264
acute myeloid leukemia 785 0.0250035612193251
lung cancer 4473 0.0254120591848701
non primary Sjogren syndrome sicca 840 0.027681647343427
oligodendroglioma 2849 0.0325892704644509
Breast cancer 3099 0.0351571162164491
Disease Target Count Z-score Confidence
Dystonia 77 5.593 2.8
Parkinson's disease 364 0.0 4.0
Disease Target Count Z-score Confidence
Autosomal recessive early-onset Parkinson disease 15 5 3.12 1.6
Disease Target Count
Dystonia 16 1

Expression

  Differential Expression (13)

Disease log2 FC p
hepatocellular carcinoma -1.300 0.000
pancreatic cancer -1.100 0.006
Multiple myeloma 1.026 0.010
ependymoma 1.400 0.013
oligodendroglioma 1.100 0.033
lung cancer 1.100 0.025
Breast cancer 2.700 0.035
non primary Sjogren syndrome sicca 1.100 0.028
pancreatic carcinoma -1.100 0.006
acute myeloid leukemia 1.600 0.025
psoriasis -1.100 0.000
Pick disease 2.100 0.000
ovarian cancer -2.400 0.000

Synonym

Accession O75569 A8K3I6 Q53G24 Q6X7T5 Q8NDK4
Symbols RAX
PACT
DYT16
HSD14

Gene

PDB

2DIX  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid
Fruitfly EggNOG Inparanoid

 Collection (1)

 OMIM Term (1)

Gene RIF (47)

PMID Text
26636761 MicroRNA-122 Inhibits the Production of Inflammatory Cytokines by Targeting the PKR Activator PACT in Human Hepatic Stellate Cells.
26608320 These findings support a model in which a measles virus defective interfering RNA is sensed by PACT and RIG-I to initiate an innate antiviral response via activation of interferon-beta production.
26454002 The interferon-induced protein kinase(PACT) partially rescued defects of interferon-beta1 and chemokine (C-C motif) ligand 5/RANTES (regulated on activation normal T cell expressed and secreted) induction in DDX3-knockdown HEK293 cells.
26355092 this study demonstrates for the first time that OV20.0 of Orf virus is also able to interact with the dsRNA binding domain of PACT and that the presence of dsRNA strengthened the interaction of these two molecules.
26231208 the affinity of PACT-PACT and PACT-PKR interactions is enhanced in dystonia patient lymphoblasts, thereby leading to intensified PKR activation and enhanced cellular death.
25142429 This stuidy provides the first independent replication of the DYT16 locus at 2q31.2 and strongly confirms the causal contribution of the PRKRA gene to DYT16. Our data suggest worldwide involvement of PRKRA in dystonia.
24939934 PKR is activated in uninfected cells, specifically during mitosis, by binding to dsRNAs formed by inverted Alu repeats (IRAlus).
24899174 NS1 prevents PACT from interacting with an essential component of the virus.
24522921 MERS-CoV 4a protein interacted with PACT in an RNA-dependent manner but not with RIG-I or MDA5.
24067967 Herpes simplex virus 1 Us11 suppresses host interferon beta1 production through the inhibition of the PACT.
More...

AA Sequence

MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRV      1 - 70
TVGDITCTGEGTSKKLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGW     71 - 140
RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENHISLTNVVGHS    141 - 210
LGCTWHSLRNSPGEKINLLKRSLLSIPNTDYIQLLSEIAKEQGFNITYLDIDELSANGQYQCLAELSTSP    211 - 280
ITVCHGSGISCGNAQSDAAHNALQYLKIIAERK                                         281 - 313
//

Text Mined References (82)

PMID Year Title
26636761 2015 MicroRNA-122 Inhibits the Production of Inflammatory Cytokines by Targeting the PKR Activator PACT in Human Hepatic Stellate Cells.
26608320 2015 PACT- and RIG-I-Dependent Activation of Type I Interferon Production by a Defective Interfering RNA Derived from Measles Virus Vaccine.
26454002 2016 DDX3 functions in antiviral innate immunity through translational control of PACT.
26355092 2015 Regulation of PACT-Mediated Protein Kinase Activation by the OV20.0 Protein of Orf Virus.
26231208 2015 Altered activation of protein kinase PKR and enhanced apoptosis in dystonia cells carrying a mutation in PKR activator protein PACT.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25142429 2014 DYT16 revisited: exome sequencing identifies PRKRA mutations in a European dystonia family.
24939934 2014 PKR is activated by cellular dsRNAs during mitosis and acts as a mitotic regulator.
24899174 2014 Quantitative proteomic analysis of the influenza A virus nonstructural proteins NS1 and NS2 during natural cell infection identifies PACT as an NS1 target protein and antiviral host factor.
More...