Property Summary

NCBI Gene PubMed Count 79
PubMed Score 34.27
PubTator Score 52.89

Knowledge Summary

Patent (12,843)

TINX Plot

  Disease (7)

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia 1.600 2.5e-02
Breast cancer 2.700 3.5e-02
ependymoma 1.400 1.3e-02
hepatocellular carcinoma -1.300 4.2e-05
lung cancer 1.100 2.5e-02
Multiple myeloma 1.026 9.8e-03
non primary Sjogren syndrome sicca 1.100 2.8e-02
oligodendroglioma 1.100 3.3e-02
ovarian cancer -2.400 1.4e-11
pancreatic cancer -1.100 6.0e-03
pancreatic carcinoma -1.100 6.0e-03
Pick disease 2.100 1.9e-06
psoriasis -1.100 1.3e-10

 OMIM Phenotype (1)

Gene RIF (51)

AA Sequence

MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRV      1 - 70
TVGDITCTGEGTSKKLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGW     71 - 140
RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENHISLTNVVGHS    141 - 210
LGCTWHSLRNSPGEKINLLKRSLLSIPNTDYIQLLSEIAKEQGFNITYLDIDELSANGQYQCLAELSTSP    211 - 280
ITVCHGSGISCGNAQSDAAHNALQYLKIIAERK                                         281 - 313
//

Text Mined References (88)

PMID Year Title