Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 7.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

Gene RIF (3)

AA Sequence

MSTLYDIRAHKAQLLRFFASSDSNKALEQRRTLHTPKLEHLDRVLYEWFLGKRSEGVPVSGPMLIEKAKD      1 - 70
FYEQMQLTEPCVFSGGWLWRFKARHGIKKLDASSEKQSADHQAAEQFCAFFRSLAAEHGLSAEQVYNADE     71 - 140
TGLFWRCLPNPTPEGGAVPGPKQGKDRLTVLMCANATGSHRLKPLAIGKCSGPRAFKGIQHLPVAYKAQG    141 - 210
NAWVDKEIFSDWFHHIFVPSVREHFRTIGLPEDSKAVLLLDSSRAHPQEAELVSSNVFTIFLPASVASLV    211 - 280
QPMEQGIRRDFMRNFINPPVPLQGPHARYNMNDAIFSVACAWNAVPSHVFRRAWRKLWPSVAFAEGSSSE    281 - 350
EELEAECFPVKPHNKSFAHILELVKEGSSCPGQLRQRQAASWGVAGREAEGGRPPAATSPAEVVWSSEKT    351 - 420
PKADQDGRGDPGEGEEVAWEQAAVAFDAVLRFAERQPCFSAQEVGQLRALRAVFRSQQQVRRRRGALGAV    421 - 490
VKVEALQEGPGGCGATAQSPLPCSSTAGDN                                            491 - 520
//

Text Mined References (11)

PMID Year Title