Property Summary

NCBI Gene PubMed Count 30
Grant Count 42
R01 Count 28
Funding $3,829,849.1
PubMed Score 520.40
PubTator Score 62.86

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
26577701 Macrophages assemble the appropriate motile machinery to infiltrate tumors and promote disease progression, and implicate SKAP2 as an attractive candidate for therapeutically targeting TAMs.
25862907 SKAP2 expression levels in NSCLC tissues could be a powerful biomarker of poor prognosis. Therefore, SKAP2 is a promising candidate molecular target for Non-small cell lung cancer treatment.
23161539 results suggest that SKAP2 negatively regulates cell migration and tumor invasion in fibroblasts and glioblastoma cells by suppressing actin assembly induced by the WAVE2-cortactin complex
22976304 Skap2 is necessary for macrophage migration, chemotaxis, global actin reorganization and local actin reorganization upon integrin engagement.
21719704 analysis of substrate specificity of lymphoid-specific tyrosine phosphatase (Lyp) and identification of Src kinase-associated protein of 55 kDa homolog (SKAP-HOM) as a Lyp substrate
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20378605 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17952125 Overexpression of SKAP2 is associated with the development of pancreatic ductal adenocarcinoma
15166227 studies provide insights into the molecular mechanism ofrelated adhesion focal tyrosine kinase (RAFTK) autophosphorylation and the specific role of Src in the regulation of RAFTK activation
More...

AA Sequence

MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAE      1 - 70
DGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKR     71 - 140
WCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEW    141 - 210
VQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQR    211 - 280
KMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPK    281 - 350
AYIMEMYDI                                                                 351 - 359
//

Text Mined References (34)

PMID Year Title
26577701 2016 SKAP2 Promotes Podosome Formation to Facilitate Tumor-Associated Macrophage Infiltration and Metastatic Progression.
25862907 2015 Src kinase-associated phosphoprotein2 expression is associated with poor prognosis in non-small cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23161539 2013 The Src substrate SKAP2 regulates actin assembly by interacting with WAVE2 and cortactin proteins.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22976304 2012 Macrophages require Skap2 and Sirp? for integrin-stimulated cytoskeletal rearrangement.
21719704 2011 Substrate specificity of lymphoid-specific tyrosine phosphatase (Lyp) and identification of Src kinase-associated protein of 55 kDa homolog (SKAP-HOM) as a Lyp substrate.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20378605 2010 In silico replication of the genome-wide association results of the Type 1 Diabetes Genetics Consortium.
More...