Property Summary

NCBI Gene PubMed Count 30
PubMed Score 520.40
PubTator Score 62.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 5.60345771519176E-26
Breast cancer 3099 8.53886058702708E-9
tuberculosis 1563 8.86704959631676E-8
pituitary cancer 1972 1.36980372808921E-7
atypical teratoid / rhabdoid tumor 4369 1.30041778221076E-6
oligodendroglioma 2849 1.51233965676597E-6
malignant mesothelioma 3163 6.73871600836211E-6
ovarian cancer 8492 1.17709853090568E-5
juvenile dermatomyositis 1189 1.96068516337253E-5
lung cancer 4473 2.14886301691603E-5
medulloblastoma, large-cell 6234 3.44539470887054E-5
group 4 medulloblastoma 1875 1.96095089247365E-4
primary pancreatic ductal adenocarcinoma 1271 3.31891749055087E-4
acute quadriplegic myopathy 1157 3.64797477471443E-4
psoriasis 6685 7.23268836195981E-4
posterior fossa group A ependymoma 1511 9.12818290454637E-4
pancreatic cancer 2300 0.00125141921143335
ductal carcinoma in situ 1745 0.00480832130310072
primary Sjogren syndrome 789 0.00516611163017009
gastric carcinoma 832 0.00616746517516819
Waldenstrons macroglobulinemia 765 0.00726325289161759
osteosarcoma 7933 0.00945704743743712
invasive ductal carcinoma 2950 0.0103539595752556
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0119626670574514
primitive neuroectodermal tumor 3031 0.0167551214570081
astrocytic glioma 2241 0.0229381834799077
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0261082196315463
glioblastoma 5572 0.036128051042714
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0475129500789527
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0
Type 1 diabetes mellitus 104 0.0 2.0

Expression

Synonym

Accession O75563 A4D173 Q53GP6 Q75MK6 Q75MZ4 Q9UBZ3 Q9UED8
Symbols PRAP
RA70
SAPS
SCAP2
SKAP55R
SKAP-HOM

Gene

PDB

3OMH  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (11)

PMID Text
26577701 Macrophages assemble the appropriate motile machinery to infiltrate tumors and promote disease progression, and implicate SKAP2 as an attractive candidate for therapeutically targeting TAMs.
25862907 SKAP2 expression levels in NSCLC tissues could be a powerful biomarker of poor prognosis. Therefore, SKAP2 is a promising candidate molecular target for Non-small cell lung cancer treatment.
23161539 results suggest that SKAP2 negatively regulates cell migration and tumor invasion in fibroblasts and glioblastoma cells by suppressing actin assembly induced by the WAVE2-cortactin complex
22976304 Skap2 is necessary for macrophage migration, chemotaxis, global actin reorganization and local actin reorganization upon integrin engagement.
21719704 analysis of substrate specificity of lymphoid-specific tyrosine phosphatase (Lyp) and identification of Src kinase-associated protein of 55 kDa homolog (SKAP-HOM) as a Lyp substrate
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20378605 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17952125 Overexpression of SKAP2 is associated with the development of pancreatic ductal adenocarcinoma
15166227 studies provide insights into the molecular mechanism ofrelated adhesion focal tyrosine kinase (RAFTK) autophosphorylation and the specific role of Src in the regulation of RAFTK activation
More...

AA Sequence

MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAE      1 - 70
DGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKR     71 - 140
WCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEW    141 - 210
VQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQR    211 - 280
KMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPK    281 - 350
AYIMEMYDI                                                                 351 - 359
//

Text Mined References (34)

PMID Year Title
26577701 2016 SKAP2 Promotes Podosome Formation to Facilitate Tumor-Associated Macrophage Infiltration and Metastatic Progression.
25862907 2015 Src kinase-associated phosphoprotein2 expression is associated with poor prognosis in non-small cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23161539 2013 The Src substrate SKAP2 regulates actin assembly by interacting with WAVE2 and cortactin proteins.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22976304 2012 Macrophages require Skap2 and Sirp? for integrin-stimulated cytoskeletal rearrangement.
21719704 2011 Substrate specificity of lymphoid-specific tyrosine phosphatase (Lyp) and identification of Src kinase-associated protein of 55 kDa homolog (SKAP-HOM) as a Lyp substrate.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20378605 2010 In silico replication of the genome-wide association results of the Type 1 Diabetes Genetics Consortium.
More...