Property Summary

NCBI Gene PubMed Count 31
Grant Count 12
R01 Count 5
Funding $978,775.52
PubMed Score 44.08
PubTator Score 44.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
gastric cancer -1.300 0.014
pancreatic cancer -1.200 0.030
cystic fibrosis -1.827 0.000
non-small cell lung carcinoma -2.000 0.000
fibroadenoma -1.300 0.041
Multiple Sclerosis 1.600 0.004
lung adenocarcinoma -2.100 0.000
pancreatic carcinoma -1.200 0.030
COPD -1.100 0.003
lung carcinoma -3.700 0.000
mucosa-associated lymphoid tissue lympho... 1.602 0.007
ductal carcinoma in situ -1.400 0.001
axial spondyloarthropathy 1.100 0.048

Gene RIF (18)

PMID Text
26176172 The results suggest that STX11 plays an important role in the pathogenesis of Peripheral T-cell lymphomas and they may contribute to the future development of new drugs for the treatment of Peripheral T-cell lymphomas.
24910990 a pivotal role for S-acylation in the function of syntaxin 11 in NK cells
24227526 Stx11 functions as a t-SNARE for the final fusion of LG at the IS.
23160464 Distinct severity of HLH in both human and murine mutants with complete loss of cytotoxic effector PRF1, RAB27A, and STX11.
22767500 Platelets deficient in syntaxin-11 from a Familial Hemophagocytic Lymphohistiocytosis type 4 had secretion defect.
21674762 No detrimental mutations were identified in STX11 in Chinese children with Epstein-Barr virus-associated hemophagocytic lymphohistiocytosis.
21342435 Data suggest that syntaxin 11 promotes the fusion of Rab27a-expressing vesicles with cytotoxic granules and reveal additional complexity in spatial/temporal segregation of subcellular structures involved in granule-mediated cytotoxicity.
21298754 STX11 should be sequenced in HLH patients even when impaired NK cell degranulation is not found
20486178 The mutations in STX11 are responsible for HLH in approximately 1% of North American patients and can cause variable defects in syntaxin 11 expression and function with resultant impact on clinical phenotype.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MKDRLAELLDLSKQYDQQFPDGDDEFDSPHEDIVFETDHILESLYRDIRDIQDENQLLVADVKRLGKQNA      1 - 70
RFLTSMRRLSSIKRDTNSIAKAIKARGEVIHCKLRAMKELSEAAEAQHGPHSAVARISRAQYNALTLTFQ     71 - 140
RAMHDYNQAEMKQRDNCKIRIQRQLEIMGKEVSGDQIEDMFEQGKWDVFSENLLADVKGARAALNEIESR    141 - 210
HRELLRLESRIRDVHELFLQMAVLVEKQADTLNVIELNVQKTVDYTGQAKAQVRKAVQYEEKNPCRTLCC    211 - 280
FCCPCLK                                                                   281 - 287
//

Text Mined References (32)

PMID Year Title
26176172 2015 STX11 functions as a novel tumor suppressor gene in peripheral T-cell lymphomas.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24910990 2014 Analysis of familial hemophagocytic lymphohistiocytosis type 4 (FHL-4) mutant proteins reveals that S-acylation is required for the function of syntaxin 11 in natural killer cells.
24227526 2014 Syntaxin11 serves as a t-SNARE for the fusion of lytic granules in human cytotoxic T lymphocytes.
23160464 2013 Distinct severity of HLH in both human and murine mutants with complete loss of cytotoxic effector PRF1, RAB27A, and STX11.
22767500 2012 Syntaxin-11, but not syntaxin-2 or syntaxin-4, is required for platelet secretion.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21674762 2012 Screening the PRF1, UNC13D, STX11, SH2D1A, XIAP, and ITK gene mutations in Chinese children with Epstein-Barr virus-associated hemophagocytic lymphohistiocytosis.
21342435 2012 Syntaxin 11 marks a distinct intracellular compartment recruited to the immunological synapse of NK cells to colocalize with cytotoxic granules.
More...