Property Summary

NCBI Gene PubMed Count 28
PubMed Score 200.84
PubTator Score 205.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.1334909652339E-6
posterior fossa group B ependymoma 1530 4.7333419817555E-6
psoriasis 6685 3.47536334081698E-5
lung carcinoma 2844 4.36831662136988E-5
cutaneous lupus erythematosus 1056 1.7038446068062E-4
pituitary cancer 1972 2.52614710466572E-4
Breast cancer 3099 2.66096751338273E-4
nasopharyngeal carcinoma 1056 3.83921950712978E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.15871096015546E-4
colon cancer 1475 0.00169296781235065
pterygium 74 0.00420548167160317
Atopic dermatitis 944 0.0108184887799087
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0200725204126913
active Crohn's disease 918 0.0231406422469599
head and neck cancer and chronic obstructive pulmonary disease 237 0.0288214038219401
Endometriosis 535 0.0326214271916233

Expression

  Differential Expression (16)

Gene RIF (15)

PMID Text
25425335 The commonly used breast carcinoma biomarkers vary in their prognostic implications. GCDFP-15 independently indicated a favourable prognosis. GATA-3 and MGB were not associated with outcome.
24706379 Results indicate that the quantitative analysis of h-MAM mRNA is a useful tool for detecting CTCs in breast cancer patients.
24603286 The data indicate that MGB1, MGB2 and LIPB mRNAs are expressed at low levels in human tissues but basal expression is upregulated in ovarian cancer.
24585249 Results indicated that SCGB2A1 represented a novel, prognostic factor for colorectal cancer, and its expression correlated with chemoresistance, radioresistance and cancer cell stemness.
23807163 SCGB2A1 is a top differentially expressed gene in all major histological types of ovarian cancers.
23332923 MGB has the highest expression in HER2-overexpressing breast cancers and may be a potentially useful marker for this subtype.
20306663 Data show that plasma mammaglobin mRNA alone or in combination with CA15.3 (CD227) may be used as a valuable noninvasive approach for the diagnosis and the detection of metastasis in breast cancer at the time of diagnosis.
19635143 MGB-2 expression characterizes less aggressive forms of EOC and is correlated with a favorable outcome
18416968 Expression levels of mammaglobins A and B in nasal polyps are not different between patients with and without AR
18021217 MGB-2 is highly expressed in endometrioid endometrial cancer [EEC], particularly in well- and moderately differentiated tumors, and may represent a novel molecular marker for EEC
16166429 Results indicate that mammaglobin, as measured by the ELISA, holds significant promise for breast cancer screening with the realistic potential to impact management of this disease.
16020486 SCGB 2A1 represents a new class of androgen target genes that are purely under indirect AR control mediated by DNA-bound Sp factors.
15151203 MGB2 markers may be useful for identifying micrometastases in sentinel lymph nodes of breast cancer patients.
12539042 Microarray analysis indicates HIV-1 Tat upregulates the expression of many proteins, including Mammaglobin, in immature dendritic cells, an effect that likely facilitates the expansion of HIV-1 infection
12022875 The mammaglobin/lipophilin B complex is a promising diagnostic marker for breast cancer.

AA Sequence

MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQS      1 - 70
HRTLKNFGLMMHTVYDSIWCNMKSN                                                  71 - 95
//

Text Mined References (30)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25425335 2015 GATA-binding protein 3, gross cystic disease fluid protein-15 and mammaglobin have distinct prognostic implications in different invasive breast carcinoma subgroups.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24706379 2014 The clinical utility of circulating tumor cells in breast cancer patients: detection by a quantitative assay of h-MAM gene expression.
24603286 2014 Differential expression of secretoglobins in normal ovary and in ovarian carcinoma--overexpression of mammaglobin-1 is linked to tumor progression.
24585249 2014 SCGB2A1 is a novel prognostic marker for colorectal cancer associated with chemoresistance and radioresistance.
23807163 2013 Mammaglobin B (SCGB2A1) is a novel tumour antigen highly differentially expressed in all major histological types of ovarian cancer: implications for ovarian cancer immunotherapy.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23332923 2013 Expression of mammaglobin and gross cystic disease fluid protein-15 in breast carcinomas.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22155607 2011 Update of the human secretoglobin (SCGB) gene superfamily and an example of 'evolutionary bloom' of androgen-binding protein genes within the mouse Scgb gene superfamily.
20306663 2007 Plasma mammaglobin messenger RNA in breast cancer patients as an addition to serum tumor.
19635143 2009 Mammaglobin B is an independent prognostic marker in epithelial ovarian cancer and its expression is associated with reduced risk of disease recurrence.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18416968 Expression of mammaglobins A and B in nasal polyps is similar in patients with and without allergic rhinitis.
18021217 Mammaglobin B expression in human endometrial cancer.
16395610 2006 Immunohistochemical analysis of secretoglobin SCGB 2A1 expression in human ocular glands and tissues.
16166429 2005 Identification of mammaglobin as a novel serum marker for breast cancer.
16020486 2005 Secretoglobin 2A1 is under selective androgen control mediated by a peculiar binding site for Sp family transcription factors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15151203 2004 RT-PCR for mammaglobin genes, MGB1 and MGB2, identifies breast cancer micrometastases in sentinel lymph nodes.
12826312 2003 Dysregulated secretoglobin expression in human lung cancers.
12539042 2003 HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12022875 2002 Purification and characterization of the mammaglobin/lipophilin B complex, a promising diagnostic marker for breast cancer.
11446459 2001 Lacryglobin in human tears, a potential marker for cancer.
10066439 1999 Lipophilins: human peptides homologous to rat prostatein.
9806831 1998 Identification of mammaglobin B, a novel member of the uteroglobin gene family.
9720917 1998 Lipophilin, a novel heterodimeric protein of human tears.
9504814 1997 Establishment of the human reflex tear two-dimensional polyacrylamide gel electrophoresis reference map: new proteins of potential diagnostic value.