Property Summary

NCBI Gene PubMed Count 30
PubMed Score 210.56
PubTator Score 205.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 1.593 2.3e-02
Atopic dermatitis -1.700 1.1e-02
Breast cancer -2.700 2.7e-04
colon cancer -2.000 1.2e-02
cutaneous lupus erythematosus -3.800 1.7e-04
Endometriosis -1.220 3.3e-02
ependymoma 1.500 1.6e-02
head and neck cancer and chronic obstruc... -1.200 2.9e-02
intraductal papillary-mucinous adenoma (... 3.600 7.2e-04
intraductal papillary-mucinous neoplasm ... 2.800 2.0e-02
lung carcinoma 1.200 4.4e-05
nasopharyngeal carcinoma -2.300 3.8e-04
ovarian cancer 4.400 2.1e-06
pituitary cancer -2.600 2.5e-04
psoriasis -1.700 6.8e-06
pterygium -1.500 4.2e-03

Synonym

Accession O75556
Symbols LPHC
LPNC
MGB2
UGB3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (16)

AA Sequence

MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQS      1 - 70
HRTLKNFGLMMHTVYDSIWCNMKSN                                                  71 - 95
//

Text Mined References (32)

PMID Year Title