Property Summary

NCBI Gene PubMed Count 28
PubMed Score 200.84
PubTator Score 205.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.1334909652339E-6
posterior fossa group B ependymoma 1530 4.7333419817555E-6
psoriasis 6685 3.47536334081698E-5
lung carcinoma 2844 4.36831662136988E-5
cutaneous lupus erythematosus 1056 1.7038446068062E-4
pituitary cancer 1972 2.52614710466572E-4
Breast cancer 3099 2.66096751338273E-4
nasopharyngeal carcinoma 1056 3.83921950712978E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.15871096015546E-4
colon cancer 1475 0.00169296781235065
pterygium 74 0.00420548167160317
Atopic dermatitis 944 0.0108184887799087
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0200725204126913
active Crohn's disease 918 0.0231406422469599
head and neck cancer and chronic obstructive pulmonary disease 237 0.0288214038219401
Endometriosis 535 0.0326214271916233

Expression

  Differential Expression (16)

Gene RIF (15)

PMID Text
25425335 The commonly used breast carcinoma biomarkers vary in their prognostic implications. GCDFP-15 independently indicated a favourable prognosis. GATA-3 and MGB were not associated with outcome.
24706379 Results indicate that the quantitative analysis of h-MAM mRNA is a useful tool for detecting CTCs in breast cancer patients.
24603286 The data indicate that MGB1, MGB2 and LIPB mRNAs are expressed at low levels in human tissues but basal expression is upregulated in ovarian cancer.
24585249 Results indicated that SCGB2A1 represented a novel, prognostic factor for colorectal cancer, and its expression correlated with chemoresistance, radioresistance and cancer cell stemness.
23807163 SCGB2A1 is a top differentially expressed gene in all major histological types of ovarian cancers.
23332923 MGB has the highest expression in HER2-overexpressing breast cancers and may be a potentially useful marker for this subtype.
20306663 Data show that plasma mammaglobin mRNA alone or in combination with CA15.3 (CD227) may be used as a valuable noninvasive approach for the diagnosis and the detection of metastasis in breast cancer at the time of diagnosis.
19635143 MGB-2 expression characterizes less aggressive forms of EOC and is correlated with a favorable outcome
18416968 Expression levels of mammaglobins A and B in nasal polyps are not different between patients with and without AR
18021217 MGB-2 is highly expressed in endometrioid endometrial cancer [EEC], particularly in well- and moderately differentiated tumors, and may represent a novel molecular marker for EEC
More...

AA Sequence

MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQS      1 - 70
HRTLKNFGLMMHTVYDSIWCNMKSN                                                  71 - 95
//

Text Mined References (30)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25425335 2015 GATA-binding protein 3, gross cystic disease fluid protein-15 and mammaglobin have distinct prognostic implications in different invasive breast carcinoma subgroups.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24706379 2014 The clinical utility of circulating tumor cells in breast cancer patients: detection by a quantitative assay of h-MAM gene expression.
24603286 2014 Differential expression of secretoglobins in normal ovary and in ovarian carcinoma--overexpression of mammaglobin-1 is linked to tumor progression.
24585249 2014 SCGB2A1 is a novel prognostic marker for colorectal cancer associated with chemoresistance and radioresistance.
23807163 2013 Mammaglobin B (SCGB2A1) is a novel tumour antigen highly differentially expressed in all major histological types of ovarian cancer: implications for ovarian cancer immunotherapy.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23332923 2013 Expression of mammaglobin and gross cystic disease fluid protein-15 in breast carcinomas.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
More...