Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.17
PubTator Score 2.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
group 4 medulloblastoma 1855 6.0e-05
subependymal giant cell astrocytoma 2287 4.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Substance abuse 59 3.189 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma 1.100 6.0e-05
subependymal giant cell astrocytoma -1.045 4.9e-02

Gene RIF (1)

AA Sequence

MSRRKQTNPNKVHWDQVFAGLEEQARQAMMKTDFPGDLGSQRQAIQQLRDQDSSSSDSEGDEEETTQDEV      1 - 70
SSHTSEEDGGVVKVEKELENTEQPVGGNEVVEHEVTGNLNSDPLLELCQCPLCQLDCGSREQLIAHVYQH     71 - 140
TAAVVSAKSYMCPVCGRALSSPGSLGRHLLIHSEDQRSNCAVCGARFTSHATFNSEKLPEVLNMESLPTV    141 - 210
HNEGPSSAEGKDIAFSPPVYPAGILLVCNNCAAYRKLLEAQTPSVRKWALRRQNEPLEVRLQRLERERTA    211 - 280
KKSRRDNETPEEREVRRMRDREAKRLQRMQETDEQRARRLQRDREAMRLKRANETPEKRQARLIREREAK    281 - 350
RLKRRLEKMDMMLRAQFGQDPSAMAALAAEMNFFQLPVSGVELDSQLLGKMAFEEQNSSSLH            351 - 412
//

Text Mined References (12)

PMID Year Title