Property Summary

NCBI Gene PubMed Count 127
PubMed Score 40.43
PubTator Score 157.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Intracranial aneurysm 24 0.0 2.6
Disease Target Count Z-score Confidence
Pityriasis rubra pilaris 4 3.262 1.6
Thrombocytosis 38 3.041 1.5

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.500 6.4e-03
atypical teratoid / rhabdoid tumor 1.500 5.3e-04
ependymoma 1.300 9.2e-03
Gaucher disease type 1 -1.300 1.9e-02
glioblastoma 1.200 7.8e-03
medulloblastoma, large-cell 1.200 2.0e-04
oligodendroglioma 1.400 5.0e-03
osteosarcoma -1.254 1.5e-02
ovarian cancer -1.900 5.3e-07
pancreatic ductal adenocarcinoma liver m... 1.174 3.1e-02
Pick disease -1.100 1.4e-05
primitive neuroectodermal tumor 1.200 5.0e-04
progressive supranuclear palsy -1.300 3.6e-03
psoriasis -2.400 1.7e-05
sonic hedgehog group medulloblastoma 1.100 1.1e-04

Gene RIF (103)

AA Sequence

MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDY      1 - 70
SSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGG     71 - 140
KTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGA    141 - 210
TPKKLSSWDQAETPGHTPSLRWDETPGRAKGSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPG    211 - 280
HGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGST    281 - 350
PVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAG    351 - 420
YVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLVDVDESTLSPE    421 - 490
EQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRIL    491 - 560
YKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTAR    561 - 630
AFAVVASALGIPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQK    631 - 700
VRTISALAIAALAEAATPYGIESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVM    701 - 770
LILIREFQSPDEEMKKIVLKVVKQCCGTDGVEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVEL    771 - 840
ANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAFQEQTTEDSVM    841 - 910
LNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAVVMKTCQEEKLMGHLGVVLYE    911 - 980
YLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVGRIADRGAEYV    981 - 1050
SAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVA   1051 - 1120
ETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASA   1121 - 1190
VVQHMSLGVYGFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARK   1191 - 1260
VRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYELDYIL                             1261 - 1304
//

Text Mined References (151)

PMID Year Title