Property Summary

NCBI Gene PubMed Count 46
Grant Count 32
R01 Count 9
Funding $10,356,811.75
PubMed Score 139.84
PubTator Score 74.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (34)

PMID Text
25326896 Data show that overall enhancer of zeste 2 (EZH2), embryonic ectoderm development (EED) and suppressor of zeste 12 homolog (SUZ12) expression in the colorectal cancer (CRC) tissues was significantly increased than in the non-cancerous tissue.
25264103 EED, a component of Polycomb repressive complex-2 (PRC2) that catalyzes methylation of lysine 27 of histone H3 (H3K27), was involved in epithelial-mesenchymal transition (EMT) of cancer cells induced by Transforming Growth Factor-beta (TGF-beta).
25240281 Polycomb repressive complex 2 is recurrently inactivated through EED or SUZ12 loss in malignant peripheral nerve sheath tumors.
24457600 An integral role for EED as an epigenetic exchange factor coordinating the activities of PRC1 and 2, is reported.
24320048 EZH2-EED is necessary and sufficient for binding to the lncRNA HOTAIR.
23982173 Although inactivating mutations in PRC2-encoding genes EZH2, EED, and SUZ12 are present in T-cell acute lymphoblastic leukemia and in myeloid malignancies, gain-of-function mutations in EZH2 are frequently observed in B-cell lymphoma.
23709348 These results suggest that the SNPs of the EED gene might not be associated with susceptibility to CRC.
22733077 EED mutants impair polycomb repressive complex 2 and is associated with myelodysplastic syndrome and related neoplasms
22308284 Genetic defects in PRC2 components other than EZH2 are not common in myeloid malignancies.
22271413 Promoter polymorphism of the EED gene is associated with the susceptibility to ulcerative colitis.
More...

AA Sequence

MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGK      1 - 70
GKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVD     71 - 140
ADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVS    141 - 210
KDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDY    211 - 280
NPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNV    281 - 350
TILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSR    351 - 420
DSSILIAVCDDASIWRWDRLR                                                     421 - 441
//

Text Mined References (66)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25326896 2015 Expression and clinicopathological significance of EED, SUZ12 and EZH2 mRNA in colorectal cancer.
25264103 2014 EED regulates epithelial-mesenchymal transition of cancer cells induced by TGF-?.
25240281 2014 PRC2 is recurrently inactivated through EED or SUZ12 loss in malignant peripheral nerve sheath tumors.
24457600 2014 The central role of EED in the orchestration of polycomb group complexes.
24320048 2013 Binding interactions between long noncoding RNA HOTAIR and PRC2 proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23982173 2013 Polycomb repressive complex 2 (PRC2) suppresses E?-myc lymphoma.
23709348 2013 EED gene polymorphism in patients with colorectal cancer.
23273982 2013 An H3K36 methylation-engaging Tudor motif of polycomb-like proteins mediates PRC2 complex targeting.
More...