Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.42
PubTator Score 2.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.200 3.0e-02
osteosarcoma -2.666 7.3e-08
psoriasis -1.100 8.3e-04
tuberculosis and treatment for 6 months 1.100 3.0e-04

Gene RIF (6)

AA Sequence

MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQY      1 - 70
EVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQL     71 - 140
QTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLY    141 - 210
ASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDS    211 - 280
KLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEDDEDDNAGTEMKILRGHCGPVYSTRF    281 - 350
LADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDLDISPYSLYFASGSHDRTARLWSFDRTYPLR    351 - 420
IYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQ    421 - 490
RLKLWDLASGTLYKELRGHTDNITSLTFSPDSGLIASASMDNSVRVWDIRNTYCSAPADGSSSELVGVYT    491 - 560
GQMSNVLSVQFMACNLLLVTGITQENQEH                                             561 - 589
//

Text Mined References (18)

PMID Year Title