Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.42
PubTator Score 2.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.100 0.001
osteosarcoma -2.666 0.000
tuberculosis and treatment for 6 months 1.100 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.030

Synonym

Accession O75529 Q5TDI5 Q5TDI6 Q8IW31
Symbols PAF65B

Gene

Gene RIF (6)

PMID Text
17476304 latent cytoplasmic coactivator TORC2 mediates target gene activation in response to cAMP signaling by associating with CBP/p300 and increasing its recruitment to a subset of CREB target genes
16829519 PCAF is a histone acetyltransferase which regulates gene transcription. PCAF interacts physically and functionally with PTEN. PTEN acetylation by PCAF block the ability of PTEN to downregulate PI3-K signalling and to induce G1 cell cycle arrest.
16672693 p300 or PCAF maintains myoblast viability as effectively as added growth factors through mechanisms requiring the acetyltransferase activity of PCAF but not of p300.
16206511 Observational study of gene-disease association. (HuGE Navigator)
16206511 The TAF5L gene on chromosome 1q42 is associated tie type 1 diabetes in Russian patients.
16126174 p300 can acetylate DNA-bound Myc:Max complexes and that acetylated Myc:Max heterodimers efficiently interact with Miz-1

AA Sequence

MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQY      1 - 70
EVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQL     71 - 140
QTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLY    141 - 210
ASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDS    211 - 280
KLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEDDEDDNAGTEMKILRGHCGPVYSTRF    281 - 350
LADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDLDISPYSLYFASGSHDRTARLWSFDRTYPLR    351 - 420
IYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQ    421 - 490
RLKLWDLASGTLYKELRGHTDNITSLTFSPDSGLIASASMDNSVRVWDIRNTYCSAPADGSSSELVGVYT    491 - 560
GQMSNVLSVQFMACNLLLVTGITQENQEH                                             561 - 589
//

Text Mined References (18)

PMID Year Title
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
23620142 2013 Genome-wide and gene-centric analyses of circulating myeloperoxidase levels in the charge and care consortia.
17476304 2007 Cooperative interactions between CBP and TORC2 confer selectivity to CREB target gene expression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16829519 2006 PCAF modulates PTEN activity.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16672693 2006 Muscle cell survival mediated by the transcriptional coactivators p300 and PCAF displays different requirements for acetyltransferase activity.
16206511 2005 The TAF5L gene on chromosome 1q42 is associated with type 1 diabetes in Russian affected patients.
16126174 2005 Six lysine residues on c-Myc are direct substrates for acetylation by p300.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...