Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.08
PubTator Score 6.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Male infertility 206 3.878 1.9

Expression

Gene RIF (4)

AA Sequence

MVEADRPGKLFIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKAAARDMN      1 - 70
GKSLDGKAIKVAQATKPAFESSRRGPPPPRSRGRPRFLRGTRGGGGGPRRSPSRGGPDDDGGYTADFDLR     71 - 140
PSRAPMPMKRGPPPRRVGPPPKRAAPSGPARSSGGGMRGRALAVRGRDGYSGPPRREPLPPRRDPYLGPR    141 - 210
DEGYSSRDGYSSRDYREPRGFAPSPGEYTHRDYGHSSVRDDCPLRGYSDRDGYGGRDRDYGDHLSRGSHR    211 - 280
EPFESYGELRGAAPGRGTPPSYGGGGRYEEYRGYSPDAYSGGRDSYSSSYGRSDRYSRGRHRVGRPDRGL    281 - 350
SLSMERGCPPQRDSYSRSGCRVPRGGGRLGGRLERGGGRSRY                                351 - 392
//

Text Mined References (12)

PMID Year Title