Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.08
PubTator Score 6.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Male infertility 170 3.885 1.9

Expression

Gene RIF (4)

PMID Text
21327109 The initial recruitment of hnRNP G to nascent pre-mRNAs is independent of its sequence-specific RNA binding properties.
20607830 nuclear hnRNP G level as well as hTra2-beta1 level were independent prognostic factors for endometrial cancer progression-free survival
19893608 germ cell-specific RBMY and hnRNP G-T proteins were more efficient in stimulating TLE4-T incorporation than somatically expressed hnRNP G protein.
12389739 Heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) is a germ cell-specific protein expressed most prominently during meiosis

AA Sequence

MVEADRPGKLFIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKAAARDMN      1 - 70
GKSLDGKAIKVAQATKPAFESSRRGPPPPRSRGRPRFLRGTRGGGGGPRRSPSRGGPDDDGGYTADFDLR     71 - 140
PSRAPMPMKRGPPPRRVGPPPKRAAPSGPARSSGGGMRGRALAVRGRDGYSGPPRREPLPPRRDPYLGPR    141 - 210
DEGYSSRDGYSSRDYREPRGFAPSPGEYTHRDYGHSSVRDDCPLRGYSDRDGYGGRDRDYGDHLSRGSHR    211 - 280
EPFESYGELRGAAPGRGTPPSYGGGGRYEEYRGYSPDAYSGGRDSYSSSYGRSDRYSRGRHRVGRPDRGL    281 - 350
SLSMERGCPPQRDSYSRSGCRVPRGGGRLGGRLERGGGRSRY                                351 - 392
//

Text Mined References (12)

PMID Year Title
21327109 Novel domains in the hnRNP G/RBMX protein with distinct roles in RNA binding and targeting nascent transcripts.
20607830 2011 Expression levels of hnRNP G and hTra2-beta1 correlate with opposite outcomes in endometrial cancer biology.
19893608 2009 The germ cell nuclear proteins hnRNP G-T and RBMY activate a testis-specific exon.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12389739 2002 Localization of the germ cell-specific protein, hnRNP G-T, in testicular biopsies of azoospermic men.
More...