Property Summary

NCBI Gene PubMed Count 27
PubMed Score 192.02
PubTator Score 549.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.52742396707577E-10
malignant mesothelioma 3163 8.73365738265766E-6
group 4 medulloblastoma 1875 1.85213103157717E-4
lung cancer 4473 3.99982413657608E-4
medulloblastoma, large-cell 6234 7.86199356666773E-4
Pick disease 1893 0.00153668966421818
pilocytic astrocytoma 3086 0.00539622446329483
non primary Sjogren syndrome sicca 840 0.0131685731252263
ependymoma 2514 0.0143350605997209
Endometriosis 535 0.0330980930971423
primitive neuroectodermal tumor 3031 0.0391740473603195

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
ependymoma -2.100 0.014
group 4 medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -3.500 0.000
medulloblastoma, large-cell -2.500 0.001
primitive neuroectodermal tumor -1.700 0.039
lung cancer 2.200 0.000
pilocytic astrocytoma 1.200 0.005
non primary Sjogren syndrome sicca 1.300 0.013
Endometriosis -1.350 0.033
Pick disease -1.200 0.002

Synonym

Accession O75525 Q6NUL8 Q9UPA8
Symbols Etle
SALP
SLM2
SLM-2
TSTAR
T-STAR
etoile

Gene

PDB

5EL3   5ELR   5ELS   5ELT   5EMO  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

 IMPC Term (1)

Gene RIF (11)

PMID Text
26758068 Sam68 and T-STAR could regulate alternative splicing of some pre-mRNAs by bringing two distant UAA motifs into proximity and looping out regions of the pre-mRNA.
23923007 Nuclear T-STAR protein expression correlates with HER2 status, hormone receptor negativity and prolonged recurrence free survival in primary breast cancer and decreased cancer cell growth in vitro.
23333304 HIV-1 Vif upregulates the expression of KH domain containing, RNA binding, signal transduction associated 3 (KHDRBS3) in Vif-expression T cells
21725612 SerpinB5 interacts with KHDRBS3 and FBXO32, and KHDRBS3 can interact with FBXO32 mRNA.
19584924 data implicate hsa-miR-30b, hsa-miR-30d and KHDRBS3 as putative oncogenic target(s) of a novel recurrent medulloblastoma amplicon at 8q24.22-q24.23
19254361 HIV-1 Vif upregulates the expression of KH domain containing, RNA binding, signal transduction associated 3 (KHDRBS3) in Vif-expression T cells
19091369 HIV-1 Vif upregulates the expression of KH domain containing, RNA binding, signal transduction associated 3 (KHDRBS3) in Vif-expression T cells
18976975 Knockdown of KH domain containing, RNA binding, signal transduction associated 3 (KHDRBS3) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication
16810759 The T-STAR gene may participate in regulation of telomerase activity in human colon cancer HCT-116 cells in a parallel fashion.
15901763 SLM-2-dependent VEGF splicing indicates the importance of mRNA splice site selection for glomerular filtration barrier function.
More...

AA Sequence

MEEKYLPELMAEKDSLDPSFTHALRLVNQEIEKFQKGEGKDEEKYIDVVINKNMKLGQKVLIPVKQFPKF      1 - 70
NFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEA     71 - 140
YARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSENADVPVVRGKPTLRTRGVPAPAITRGRGGVT    141 - 210
ARPVGVVVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYD    211 - 280
EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPSARTAKGVYRDQPYGRY        281 - 346
//

Text Mined References (28)

PMID Year Title
26758068 2016 Structural basis of RNA recognition and dimerization by the STAR proteins T-STAR and Sam68.
25416956 2014 A proteome-scale map of the human interactome network.
23923007 2013 Nuclear T-STAR protein expression correlates with HER2 status, hormone receptor negativity and prolonged recurrence free survival in primary breast cancer and decreased cancer cell growth in vitro.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21725612 2011 SerpinB5 interacts with KHDRBS3 and FBXO32 in gastric cancer cells.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19584924 2009 Amplification and overexpression of Hsa-miR-30b, Hsa-miR-30d and KHDRBS3 at 8q24.22-q24.23 in medulloblastoma.
19561594 2009 Rapid and systematic analysis of the RNA recognition specificities of RNA-binding proteins.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
More...