Property Summary

NCBI Gene PubMed Count 30
PubMed Score 199.95
PubTator Score 549.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 5.6e-03
atypical teratoid / rhabdoid tumor -2.700 3.6e-06
Endometriosis -1.350 3.3e-02
ependymoma -2.100 1.4e-02
group 4 medulloblastoma -1.900 1.0e-04
lung cancer 2.200 4.0e-04
malignant mesothelioma 1.200 8.7e-06
medulloblastoma, large-cell -1.100 9.5e-03
non primary Sjogren syndrome sicca 1.300 1.3e-02
Pick disease -1.200 1.5e-03
primitive neuroectodermal tumor -1.100 4.4e-02

 IMPC Phenotype (2)

Gene RIF (11)

AA Sequence

MEEKYLPELMAEKDSLDPSFTHALRLVNQEIEKFQKGEGKDEEKYIDVVINKNMKLGQKVLIPVKQFPKF      1 - 70
NFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEA     71 - 140
YARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSENADVPVVRGKPTLRTRGVPAPAITRGRGGVT    141 - 210
ARPVGVVVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYD    211 - 280
EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPSARTAKGVYRDQPYGRY        281 - 346
//

Text Mined References (32)

PMID Year Title