Property Summary

NCBI Gene PubMed Count 27
Grant Count 37
R01 Count 29
Funding $7,229,144.58
PubMed Score 192.02
PubTator Score 549.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
ependymoma -2.100 0.014
group 4 medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -3.500 0.000
medulloblastoma, large-cell -2.500 0.001
primitive neuroectodermal tumor -1.700 0.039
lung cancer 2.200 0.000
pilocytic astrocytoma 1.200 0.005
non primary Sjogren syndrome sicca 1.300 0.013
Endometriosis -1.350 0.033
Pick disease -1.200 0.002

Gene RIF (11)

PMID Text
26758068 Sam68 and T-STAR could regulate alternative splicing of some pre-mRNAs by bringing two distant UAA motifs into proximity and looping out regions of the pre-mRNA.
23923007 Nuclear T-STAR protein expression correlates with HER2 status, hormone receptor negativity and prolonged recurrence free survival in primary breast cancer and decreased cancer cell growth in vitro.
23333304 HIV-1 Vif upregulates the expression of KH domain containing, RNA binding, signal transduction associated 3 (KHDRBS3) in Vif-expression T cells
21725612 SerpinB5 interacts with KHDRBS3 and FBXO32, and KHDRBS3 can interact with FBXO32 mRNA.
19584924 data implicate hsa-miR-30b, hsa-miR-30d and KHDRBS3 as putative oncogenic target(s) of a novel recurrent medulloblastoma amplicon at 8q24.22-q24.23
19254361 HIV-1 Vif upregulates the expression of KH domain containing, RNA binding, signal transduction associated 3 (KHDRBS3) in Vif-expression T cells
19091369 HIV-1 Vif upregulates the expression of KH domain containing, RNA binding, signal transduction associated 3 (KHDRBS3) in Vif-expression T cells
18976975 Knockdown of KH domain containing, RNA binding, signal transduction associated 3 (KHDRBS3) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication
16810759 The T-STAR gene may participate in regulation of telomerase activity in human colon cancer HCT-116 cells in a parallel fashion.
15901763 SLM-2-dependent VEGF splicing indicates the importance of mRNA splice site selection for glomerular filtration barrier function.
More...

AA Sequence

MEEKYLPELMAEKDSLDPSFTHALRLVNQEIEKFQKGEGKDEEKYIDVVINKNMKLGQKVLIPVKQFPKF      1 - 70
NFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEA     71 - 140
YARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSENADVPVVRGKPTLRTRGVPAPAITRGRGGVT    141 - 210
ARPVGVVVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYD    211 - 280
EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPSARTAKGVYRDQPYGRY        281 - 346
//

Text Mined References (28)

PMID Year Title
26758068 2016 Structural basis of RNA recognition and dimerization by the STAR proteins T-STAR and Sam68.
25416956 2014 A proteome-scale map of the human interactome network.
23923007 2013 Nuclear T-STAR protein expression correlates with HER2 status, hormone receptor negativity and prolonged recurrence free survival in primary breast cancer and decreased cancer cell growth in vitro.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21725612 2011 SerpinB5 interacts with KHDRBS3 and FBXO32 in gastric cancer cells.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19584924 2009 Amplification and overexpression of Hsa-miR-30b, Hsa-miR-30d and KHDRBS3 at 8q24.22-q24.23 in medulloblastoma.
19561594 2009 Rapid and systematic analysis of the RNA recognition specificities of RNA-binding proteins.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
More...