Property Summary

NCBI Gene PubMed Count 25
PubMed Score 24.05
PubTator Score 18.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (5)

AA Sequence

MAMAYLAWRLARRSCPSSLQVTSFPVVQLHMNRTAMRASQKDFENSMNQVKLLKKDPGNEVKLKLYALYK      1 - 70
QATEGPCNMPKPGVFDLINKAKWDAWNALGSLPKEAARQNYVDLVSSLSPSLESSSQVEPGTDRKSTGFE     71 - 140
TLVVTSEDGITKIMFNRPKKKNAINTEMYHEIMRALKAASKDDSIITVLTGNGDYYSSGNDLTNFTDIPP    141 - 210
GGVEEKAKNNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPE    211 - 280
GCSSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKE    281 - 350
VIRKREREKLHAVNAEECNVLQGRWLSDECTNAVVNFLSRKSKL                              351 - 394
//

Text Mined References (30)

PMID Year Title