Property Summary

NCBI Gene PubMed Count 23
Grant Count 1
Funding $151,152.4
PubMed Score 23.15
PubTator Score 18.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O75521 Q5JYK5 Q5JYK7 Q7L124 Q8N0X0 Q9BUE9 Q9H0T9 Q9NQH1 Q9NYH7 Q9UN55
Symbols DRS1
PECI
ACBD2
DRS-1
HCA88
dJ1013A10.3

Gene

PANTHER Protein Class (1)

 Grant Application (1)

PDB

2CQU   2F6Q   4U18   4U19   4U1A  

Gene RIF (4)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
15217832 DRS-1 may serve as an autoantigen eliciting immune attack against hematopoietic stem cells in a subset of acquired aplastic anemia patients characterized by increased paroxysmal nocturnal hemoglobinuria-type cells
11916962 Disruption of mitochondrial beta -oxidation of unsaturated fatty acids in the 3,2-trans-enoyl-CoA isomerase-deficient mouse

AA Sequence

MAMAYLAWRLARRSCPSSLQVTSFPVVQLHMNRTAMRASQKDFENSMNQVKLLKKDPGNEVKLKLYALYK      1 - 70
QATEGPCNMPKPGVFDLINKAKWDAWNALGSLPKEAARQNYVDLVSSLSPSLESSSQVEPGTDRKSTGFE     71 - 140
TLVVTSEDGITKIMFNRPKKKNAINTEMYHEIMRALKAASKDDSIITVLTGNGDYYSSGNDLTNFTDIPP    141 - 210
GGVEEKAKNNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPE    211 - 280
GCSSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKE    281 - 350
VIRKREREKLHAVNAEECNVLQGRWLSDECTNAVVNFLSRKSKL                              351 - 394
//

Text Mined References (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25515061 2015 Human ?³,?²-enoyl-CoA isomerase, type 2: a structural enzymology study on the catalytic role of its ACBP domain and helix-10.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
19946888 2010 Defining the membrane proteome of NK cells.
More...