Property Summary

NCBI Gene PubMed Count 35
Grant Count 79
R01 Count 12
Funding $18,155,750.55
PubMed Score 320.33
PubTator Score 99.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma 2.100 0.000
ependymoma -2.900 0.031
astrocytoma -1.100 0.000
glioblastoma -1.900 0.041
oligodendroglioma -1.600 0.000
osteosarcoma 1.331 0.000
group 3 medulloblastoma -2.700 0.023
atypical teratoid/rhabdoid tumor -3.300 0.000
primitive neuroectodermal tumor -2.600 0.020
Atopic dermatitis -1.700 0.013
adrenocortical carcinoma -1.847 0.000
primary pancreatic ductal adenocarcinoma 2.276 0.000
non-small cell lung cancer -1.644 0.000
intraductal papillary-mucinous carcinoma... -1.200 0.022
cystic fibrosis 1.100 0.039
pediatric high grade glioma -2.000 0.010
subependymal giant cell astrocytoma -4.952 0.008
invasive ductal carcinoma -3.500 0.002
breast carcinoma -2.700 0.000
Breast cancer -4.400 0.000
ovarian cancer -4.500 0.000
pituitary cancer -2.300 0.000
pancreatic cancer 2.200 0.001

Synonym

Accession O75508 B2R7C1 D3DNQ5 Q5U0P3
Symbols OSP
OTM

Gene

PANTHER Protein Class (2)

Gene RIF (14)

PMID Text
26134929 the expression of miR-99b was inversely correlated with CLDN11 levels . These findings suggest that a high level of miR-99b expression is an independent prognostic factor and correlates with poor survival of patients with Hepatocellular carcinoma (HCC)
24999589 CLDN11 is an epigenetic biomarker for malignancy in dysplastic nevus and melanoma.
24268521 these data suggest that cancer cells may induce CLDN11 overexpression and subsequent collective migration of peritumoral CAFs via TGF-beta secretion.
23919729 The expression of claudin-11 was up regulated in gastric cancer tissue.
23706332 The spatial organization of claudin-11 and connexin-43 is altered in men with primary seminiferous tubule failure.
22951003 disorganization of claudin-11 expression in Sertoli cells might be one of the factors involved in the impairment of spermatogenesis.
22736761 Treatment with 3-deazaneplanocin A, an inhibitor of H3K27 methyltransferase, attenuated CLDN11 induction by serum stimulation in parallel with sustained miR-1275 expression
21468549 claudin-11 may have a role in preventing cancer progression and may serve as a therapeutic target in reducing metastasis
20850723 late spermatogenic wave may negatively regulate claudin-11 gene activation and the subcellular localization of claudin-11 in Sertoli cells, thus altering the blood testis barrier in the human testis
20546350 Claudins 11,expression in meningiomas.
More...

AA Sequence

MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVD      1 - 70
ILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCALVATIW     71 - 140
FPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTHAKSAHV       141 - 207
//

Text Mined References (36)

PMID Year Title
26134929 2015 miR-99b promotes metastasis of hepatocellular carcinoma through inhibition of claudin 11 expression and may serve as a prognostic marker.
24999589 2014 Promoter CpG island hypermethylation in dysplastic nevus and melanoma: CLDN11 as an epigenetic biomarker for malignancy.
24268521 2014 Collective migration of cancer-associated fibroblasts is enhanced by overexpression of tight junction-associated proteins claudin-11 and occludin.
23919729 2013 The distinct expression patterns of claudin-2, -6, and -11 between human gastric neoplasms and adjacent non-neoplastic tissues.
23706332 2013 Claudin-11 and connexin-43 display altered spatial patterns of organization in men with primary seminiferous tubule failure compared with controls.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22951003 2012 Expression pattern of testicular claudin-11 in infertile men.
22736761 2012 Contribution of microRNA-1275 to Claudin11 protein suppression via a polycomb-mediated silencing mechanism in human glioma stem-like cells.
21743467 2011 Seven prostate cancer susceptibility loci identified by a multi-stage genome-wide association study.
21468549 2011 Claudin-11 decreases the invasiveness of bladder cancer cells.
More...