Property Summary

NCBI Gene PubMed Count 38
PubMed Score 350.50
PubTator Score 99.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma -1.847 2.2e-05
astrocytoma -1.100 3.1e-04
Atopic dermatitis -1.700 1.3e-02
atypical teratoid / rhabdoid tumor -3.000 1.2e-03
Breast cancer -4.400 1.3e-37
breast carcinoma -2.700 5.3e-37
cystic fibrosis 1.100 3.9e-02
ependymoma -2.900 3.1e-02
glioblastoma -1.900 4.1e-02
group 3 medulloblastoma -2.700 2.3e-02
intraductal papillary-mucinous carcinoma... -1.200 2.2e-02
invasive ductal carcinoma -1.150 4.4e-02
malignant mesothelioma 2.100 2.3e-07
non-small cell lung cancer -1.644 2.8e-11
oligodendroglioma -1.600 3.4e-05
osteosarcoma 1.331 4.1e-06
ovarian cancer -4.500 1.0e-10
pancreatic cancer 2.200 9.8e-04
pediatric high grade glioma -2.000 1.0e-02
pituitary cancer -2.300 7.9e-06
primary pancreatic ductal adenocarcinoma 2.276 2.0e-04
primitive neuroectodermal tumor -2.600 2.0e-02
subependymal giant cell astrocytoma -4.952 8.2e-03

Gene RIF (16)

AA Sequence

MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVD      1 - 70
ILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCALVATIW     71 - 140
FPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTHAKSAHV       141 - 207
//

Text Mined References (39)

PMID Year Title