Property Summary

NCBI Gene PubMed Count 11
Grant Count 17
R01 Count 5
Funding $1,210,511.77
PubMed Score 10.34
PubTator Score 11.31

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 1.200 0.000
acute myeloid leukemia -1.500 0.027
ovarian cancer -1.500 0.000

Gene RIF (4)

PMID Text
24816843 HSBP1 is crucial for regulating resistance to radiotherapy of oral squamous epithelial carcinoma cells by inducing stem-like status.
21247889 HspBP1 inhibited the cytotoxic activity of the Tag7-Hsp70 complex secreted by lymphocytes. HspBP1
18767159 This study reports the crystal structure of a degradation-resistant fragment of HSBP1. A continuous, long-helix conformation of HSBP1 assembles into a coiled-coil three-helix bundle and subsequently into an elongated, symmetrical hexamer.
11679589 HSBP likely mediates its function through its trimerization domain.

AA Sequence

MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKI      1 - 70
PATQKS                                                                     71 - 76
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24816843 2014 Overexpression of HSBP1 is associated with resistance to radiotherapy in oral squamous epithelial carcinoma.
21247889 2011 The heat shock-binding protein (HspBP1) protects cells against the cytotoxic action of the Tag7-Hsp70 complex.
18767159 2009 Crystal structure of the hexamer of human heat shock factor binding protein 1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...