Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.14
PubTator Score 11.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -1.500 2.7e-02
ovarian cancer -1.500 4.4e-06
posterior fossa group B ependymoma 1.200 1.8e-09

Synonym

Accession O75506 Q53XA8 Q7Z5Z3
Symbols NPC-A-13

Gene

PDB

3CI9  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKI      1 - 70
PATQKS                                                                     71 - 76
//

Text Mined References (14)

PMID Year Title