Property Summary

NCBI Gene PubMed Count 35
PubMed Score 68.11
PubTator Score 66.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Ceroid lipofuscinosis, neuronal 5 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Blindness 88 3.375 1.7
Visual pathway disease 4 3.195 1.6
Disease Target Count
neuronal ceroid lipofuscinosis 5 2

Expression

  Differential Expression (17)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 5.4e-05
Breast cancer -1.100 2.9e-07
ependymoma 1.400 5.3e-10
glioblastoma 1.400 1.2e-02
hepatocellular carcinoma 1.100 2.4e-04
intraductal papillary-mucinous adenoma (... 1.100 1.5e-02
invasive ductal carcinoma -1.400 2.8e-03
lung cancer -1.100 1.6e-02
medulloblastoma, large-cell -1.200 9.1e-05
osteosarcoma -1.894 4.9e-05
ovarian cancer -1.500 4.9e-04
pancreatic cancer 1.200 4.4e-03
pancreatic carcinoma 1.200 4.4e-03
Pick disease 1.400 3.0e-05
psoriasis -1.300 1.6e-07
tuberculosis and treatment for 6 months -1.300 7.0e-05
ulcerative colitis -1.100 6.0e-03

 GO Function (1)

Gene RIF (20)

AA Sequence

MAQEVDTAQGAEMRRGAGAARGRASWCWALALLWLAVVPGWSRVSGIPSRRHWPVPYKRFDFRPKPDPYC      1 - 70
QAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQ     71 - 140
LGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYE    141 - 210
TWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKNIETNYTRIFLYSGEPTYLGNETSVFGPTG    211 - 280
NKTLGLAIKRFYYPFKPHLPTKEFLLSLLQIFDAVIVHKQFYLFYNFEYWFLPMKFPFIKITYEEIPLPI    281 - 350
RNKTLSGL                                                                  351 - 358
//

Text Mined References (36)

PMID Year Title