Property Summary

NCBI Gene PubMed Count 76
Grant Count 77
R01 Count 60
Funding $7,159,465.86
PubMed Score 170.95
PubTator Score 38.23

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O75496 B3KMM8 Q9H1Z1
Symbols Gem
MGORS6

Gene

PDB

4BRY   1T6F   1UII   2LP0   2WVR  

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
463097 confirmatory 71 / 236 / 973 Validation screen for small molecules that induce DNA re-replication in MCF 10A normal breast cells
463113 summary 0 / 0 / 0 qHTS assay for small molecules that induce DNA re-replication: Summary
493165 confirmatory 7 / 0 / 3 Retest of LOPAC molecules that induce DNA re-replication in SW480 adenocarcinoma cells.
493166 confirmatory 6 / 0 / 4 Retest of LOPAC molecules that induce DNA re-replication in MCF 10A normal breast cells.
504364 confirmatory 13 / 111 / 1155 Validation screen for small molecules that induce DNA re-replication in SW480 colon adenocarcinoma cells
504806 confirmatory 6 / 0 / 3 Followup screen of LOPAC molecules that induce DNA re-replication in SW480 adenocarcinoma cells
504809 confirmatory 4 / 1 / 4 Followup screen for small molecules that induce DNA re-replication in MCF 10A normal breast cells
624296 confirmatory 9908 / 51277 / 283849 A quantitative high throughput screen for small molecules that induce DNA re-replication in MCF 10a normal breast cells.
624297 confirmatory 6247 / 34352 / 303475 A quantitative high throughput screen for small molecules that induce DNA re-replication in SW480 colon adenocarcinoma cells.

Gene RIF (54)

PMID Text
26637980 De novo GMNN mutations cause autosomal-dominant primordial dwarfism associated with Meier-Gorlin syndrome.
25595275 Elevated Ki67 and geminin expression distinguish a fraction of metastatic breast carcinoma with worse prognosis.
25516969 geminin is indispensable for fetal hematopoiesis and regulates the generation of a physiological pool of stem and progenitor cells in the fetal hematopoietic system.
25231993 Bound Geminin prevents transition of the pre-replicative complexes to a state that is competent for initiation of DNA replication.
24554762 These findings suggest that E2F-mediated activation of Geminin transcription is negatively regulated by Geminin through the inhibition of chromatin remodeling.
24292956 Selective expression of geminin during the proliferative phase of the cell cycle and its nuclear specificity increase its potential to be used as an alternative marker of proliferation in breast cancer patients.
24064211 The properties of the Idas-Geminin complex suggest it as the functional form of Idas and provide a possible mechanism to modulate Geminin activity
23860238 MCM 7, geminin and topo IIalpha can be reliable tools for the differential diagnosis of reactive mesothelial cells and malignant mesothelioma cells.
23814078 Human geminin, when expressed in human cells in culture under a constitutive promoter, is excluded from the nucleus during part of the G1 phase and at the transition from G0 to G1.
23695679 The Aurora-A-geminin-Cdt1 axis represents a critical regulator of proper DNA replication.
More...

AA Sequence

MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVP      1 - 70
ESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKE     71 - 140
LAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI     141 - 209
//

Text Mined References (83)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26637980 2015 De Novo GMNN Mutations Cause Autosomal-Dominant Primordial Dwarfism Associated with Meier-Gorlin Syndrome.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25595275 2015 Expression of proliferation markers Ki67, cyclin A, geminin and aurora-kinase A in primary breast carcinomas and corresponding distant metastases.
25516969 2015 Geminin deletion increases the number of fetal hematopoietic stem cells by affecting the expression of key transcription factors.
25416956 2014 A proteome-scale map of the human interactome network.
25231993 2014 Geminin inhibits a late step in the formation of human pre-replicative complexes.
24554762 2014 Transcription of the Geminin gene is regulated by a negative-feedback loop.
24292956 2014 The potential utility of geminin as a predictive biomarker in breast cancer.
24217620 2013 The histone demethylase LSD1/KDM1A promotes the DNA damage response.
More...